KEGG   Cricetulus griseus (Chinese hamster): 100772460
Entry
100772460         CDS       T02813                                 

Gene name
Rdh5
Definition
(RefSeq) retinol dehydrogenase 5
  KO
K00061  11-cis-retinol dehydrogenase [EC:1.1.1.315]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge00830  Retinol metabolism
Brite
KEGG Orthology (KO) [BR:cge00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    100772460 (Rdh5)
Enzymes [BR:cge01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.315  11-cis-retinol dehydrogenase
     100772460 (Rdh5)
SSDB
Motif
Pfam: adh_short adh_short_C2 DUF1776 KR AHD
Other DBs
NCBI-GeneID: 100772460
NCBI-ProteinID: XP_027247921
Position
1
AA seq 318 aa
MWLPLLLGALLWAVLWLLRDQQRLPASNAFIFITGCDSGFGRLLALQLDQKGFQVLASCL
TPSGAEDLQQMASSRLHTTLLDITDPQNIQQVAKWVKTHVGETGLFGLVNNAGVAGVIGP
TPWLTQDDFQSVLNVNTLGPIGVTLALLPLLQQARGRVVNITSVLGRLAANGGGYCVSKF
GLEAFSDSLRRDMAPFGVQVSIVEPGFFRTPVTNLESLENTLKACWARLPPSTQAQYGEA
FLASYLQVQRRIMNLICDPDLTKVTSCLEHALTARHPRTRYSPGWDAKLLWLPASYLPAS
LVDAVLTWVLPQPAQSIY
NT seq 957 nt   +upstreamnt  +downstreamnt
atgtggctgcctctgcttctgggtgccttgctgtgggcagtgctgtggttgctcagagac
cagcaaagactccctgccagcaacgctttcatcttcatcactggctgtgactcaggcttt
gggcgccttctggcattgcaacttgaccagaaaggcttccaagtcctggccagctgcctg
accccctctggggcagaagacctacagcagatggcctcctcccgcctccacacaacactg
ctggatatcactgatccccagaacatccagcaggttgccaagtgggtgaagacacatgtt
ggagaaactgggctttttggtctggtgaataatgctggtgtggctggtgtcatcgggcct
acaccatggctgacacaggatgatttccagagtgtgctgaacgtgaatacactgggtccc
attggggtcacccttgccctactgcccctgctacaacaggcccgaggccgggtggttaac
atcaccagtgtcctgggtcgtctagcagccaacggtgggggctactgtgtctccaagttt
ggcctggaggccttctctgatagcctgaggcgggacatggctccatttggagtacaagtc
tccattgtggaacctggcttcttccgaactcctgtgaccaacctggagagtctagagaac
accctgaaggcttgttgggcccggctaccaccgtctacacaggcccagtatggggaagcc
ttcctcgcttcttatctccaagttcagcgtcgcatcatgaacctgatctgtgacccagac
ctaacgaaggtgaccagctgcctggagcatgccctgactgctcgtcacccccgaacccgc
tacagcccaggctgggatgccaagctgctctggctgccggcctcctaccttccagccagc
ctggtggatgctgtgctcacttgggtccttccccagcctgcccagtcaatctactga

DBGET integrated database retrieval system