KEGG   Cricetulus griseus (Chinese hamster): 100772660Help
Entry
100772660         CDS       T02813                                 

Gene name
Foxa2
Definition
(RefSeq) hepatocyte nuclear factor 3-beta isoform X2
  KO
K08035  forkhead box protein A2, hepatocyte nuclear factor 3-beta
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge04213  Longevity regulating pathway - multiple species
cge04950  Maturity onset diabetes of the young
Brite
KEGG Orthology (KO) [BR:cge00001]
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    100772660 (Foxa2)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04950 Maturity onset diabetes of the young
    100772660 (Foxa2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cge03000]
    100772660 (Foxa2)
Transcription factors [BR:cge03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix developmental regulators
    100772660 (Foxa2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Forkhead HNF_C Forkhead_N
Motif
Other DBs
NCBI-GeneID: 100772660
NCBI-ProteinID: XP_027277385
UniProt: G3HXU7
Position
6
AA seq 466 aa AA seqDB search
MHSASSMLGAVKMEGHEPSDWSSYYAEPEGYSSVSNMNAGLGMNGMNTYMSMSAAAMGGG
SGNMSAGSMNMSSYVGAGMSPSLAGMSPGAGAMAGMSGSAGAAGVAGMGPHLSPSLSPLG
GQAAGAMGGLAPYANMNSMSPMYGQAGLSRARDPKTYRRSYTHAKPPYSYISLITMAIQQ
SPNKMLTLSEIYQWIMDLFPFYRQNQQRWQNSIRHSLSFNDCFLKVPRSPDKPGKGSFWT
LHPDSGNMFENGCYLRRQKRFKCEKQLALKEAAGAGGVGGKKTAAGTQASQAQIGEAAGS
ASETPTGTESPHSSSSPCQEHKRGGLGELKGTPASALSPPEPAPSPGQQQQQAAAHLLGP
PHHPGLPPEAHLKPEHHYAFNHPFSINNLMSSEQQHHHSHHHHQPHKMDLKAYEQVMHYP
GGYGSPMPGSLAMGPVTNKTGLDASPLAADTSYYQGVYSRPIMNSS
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgcactcggcttccagtatgctgggagccgtgaagatggaagggcacgagccatccgac
tggagcagctactacgcggagccggagggttactcttccgtgagcaacatgaacgccggc
ctggggatgaacggcatgaacacttatatgagcatgtccgcggccgctatgggaggcggt
tccggcaacatgagcgcgggctccatgaacatgtcatcgtatgtgggagctggaatgagc
ccgtccctagctggcatgtctccgggcgcgggcgcaatggcgggcatgagcggctcagct
ggggcggccggcgtggccggcatgggaccgcacctgagtccaagtctgagcccactcggg
ggacaggcggccggggccatgggtggccttgctccctatgccaacatgaattcaatgagc
cccatgtacgggcaggcgggcctgagccgcgcgcgggaccccaagacataccgacgcagc
tacacacacgccaagcctccctactcctacatctcgctcatcaccatggccatccagcag
agccccaacaagatgttgacgctgagcgagatctaccagtggatcatggacctctttcct
ttctaccgacagaaccagcaacgctggcagaactccatccgtcattcgctgtccttcaac
gactgctttctcaaggtgccccgctcaccggacaagcccggcaagggctccttctggacc
ctgcaccccgactcgggcaacatgttcgagaatggttgctacttgcgccgccagaaacgc
ttcaagtgtgagaagcagctggcgctgaaggaagccgcgggtgcgggcggtgtcggaggc
aagaagacagctgctgggacccaggcttcgcaggctcagatcggagaagccgcgggctcg
gcctccgagactccgactggcaccgagtccccccattccagctcttcaccatgtcaggag
cacaagcgaggcggcctgggcgagctgaagggaacaccggcctccgcgctgagtccccca
gagccggcgccctcgcctgggcagcagcagcagcaagctgcagctcacctactgggccca
cctcaccacccgggcctaccaccggaggcccacctgaagccagagcaccattacgccttc
aaccaccccttctctatcaacaacctcatgtcctccgagcagcaacaccaccacagccac
caccaccatcaaccccacaaaatggacctcaaagcctatgaacaagtcatgcactaccct
gggggttatggttcccccatgccaggcagcttggccatgggcccagtcacgaacaaaacg
ggcctggatgcctcgcccctggctgcagacacctcctactaccagggagtgtactccagg
cctattatgaactcctcctaa

DBGET integrated database retrieval system