KEGG   Cricetulus griseus (Chinese hamster): 100773468Help
Entry
100773468         CDS       T02813                                 

Gene name
Bst1
Definition
(RefSeq) ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 2
  KO
K18152  ADP-ribosyl cyclase 2 [EC:3.2.2.6 2.4.99.20]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge00760  Nicotinate and nicotinamide metabolism
cge01100  Metabolic pathways
cge04970  Salivary secretion
cge04972  Pancreatic secretion
Brite
KEGG Orthology (KO) [BR:cge00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    100773468 (Bst1)
 09150 Organismal Systems
  09154 Digestive system
   04970 Salivary secretion
    100773468 (Bst1)
   04972 Pancreatic secretion
    100773468 (Bst1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:cge04090]
    100773468 (Bst1)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:cge00537]
    100773468 (Bst1)
Enzymes [BR:cge01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.20  2'-phospho-ADP-ribosyl cyclase/2'-phospho-cyclic-ADP-ribose transferase
     100773468 (Bst1)
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.6  ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase
     100773468 (Bst1)
CD molecules [BR:cge04090]
 Proteins
  100773468 (Bst1)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:cge00537]
 Enzymes
  100773468 (Bst1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Rib_hydrolayse
Motif
Other DBs
NCBI-GeneID: 100773468
NCBI-ProteinID: XP_027242810
Position
1
AA seq 319 aa AA seqDB search
MAAQGCTLSLWLWLWLWAPLLLPLLLGARAAAARWSGPGTTPHLQSIFLGRCAEYTTLLS
LQPGNKNCTAIWEAFKVVLDKDPCSVLPSDYDLFINLSRHSIPRDKSLFWENNHLLVMSF
SENTRRLMPLCDVLYGNVGDFLSWCRQENASGLDYQSCPTSEDCENNAVDSYWKSASMQY
SRDSSGVINVMLNGSEPKGAYPVKGFFADFEIPYLQKDKITRIEIWVMHEVGGPIVESCG
EGSVKILEDRLEALGFQHSCINDYRPVKFLMCVDHSTHPDCVMNSASASTQRESPSLFTA
VHASLIISLLVALTSSSQV
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atggccgcccagggatgtacgttgtccctgtggctgtggctgtggctgtgggcgcccctg
ctgctaccgctgctgctgggggcgcgagctgccgcagctcgatggagtgggccaggcacc
acgccgcatctgcaaagcatcttcctgggccgctgcgctgagtacacgactctgctgagc
cttcagcccgggaacaaaaactgcacagccatctgggaagccttcaaggtggttctagac
aaggacccctgctctgttcttccctcagactatgacctcttcattaacctctccaggcac
tccattcctagagacaagtcgctgttctgggagaataaccacctactcgttatgagcttc
tcagaaaacacccgtcgccttatgcccctatgtgatgttctgtatggcaacgttggagat
ttcctgagttggtgccgacaggaaaatgcctctggacttgattaccagtcctgccccaca
tcagaagactgtgaaaacaatgctgtggactcctattggaaaagtgcatccatgcagtat
tcaagagacagttctggggtgatcaatgtcatgctgaatggttcagagcccaaaggagcc
tatcctgtgaaagggttttttgcagattttgaaatcccatacttacaaaaggataaaatc
acaagaattgagatctgggtaatgcatgaagttgggggacccattgtggaatcctgtggt
gaaggcagtgtgaaaatcctggaagacagactggaggccctggggttccagcacagttgt
atcaatgactaccgaccagtgaagttcttaatgtgtgtggaccacagcactcacccggac
tgtgtcatgaactcagcttcagcatctacgcagagagaaagcccatctctttttacagca
gtgcatgccagcctgatcatctctctcttagtagcattgacttcaagttctcaagtgtga

DBGET integrated database retrieval system