KEGG   Cricetulus griseus (Chinese hamster): 100773774Help
Entry
100773774         CDS       T02813                                 

Gene name
Cat
Definition
(RefSeq) catalase isoform X1
  KO
K03781  catalase [EC:1.11.1.6]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge00380  Tryptophan metabolism
cge00630  Glyoxylate and dicarboxylate metabolism
cge01100  Metabolic pathways
cge01200  Carbon metabolism
cge04068  FoxO signaling pathway
cge04146  Peroxisome
cge04211  Longevity regulating pathway
cge04213  Longevity regulating pathway - multiple species
cge05014  Amyotrophic lateral sclerosis (ALS)
Brite
KEGG Orthology (KO) [BR:cge00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    100773774 (Cat)
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    100773774 (Cat)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    100773774 (Cat)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    100773774 (Cat)
 09150 Organismal Systems
  09149 Aging
   04211 Longevity regulating pathway
    100773774 (Cat)
   04213 Longevity regulating pathway - multiple species
    100773774 (Cat)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis (ALS)
    100773774 (Cat)
Enzymes [BR:cge01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.6  catalase
     100773774 (Cat)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Catalase Catalase-rel
Motif
Other DBs
NCBI-GeneID: 100773774
NCBI-ProteinID: XP_027278163
UniProt: G3GYY6
Position
6
AA seq 555 aa AA seqDB search
MRFLTPGGDFQRAQLSCSPRSAAPKSYTMADSRDPASDQMKHWKEQRSLQKPDVLTTGGG
NPIGDKLNIMTAGSRGPLLVQDVVFTDEMAHFDRERIPERVVHAKGAGAFGYFEVTHDIT
RYCKAKVFEHIGKRTPIAVRFSTVAGESGSADTVRDPRGFAVKFYTEDGNWDLVGNNTPI
FFIRDAILFPSFIHSQKRNPQTHLKDPDMVWDFWSLRPESLHQVSFLFSDRGIPDGHRHM
NGYGSHTFKLVNANGEAVYCKFHYKTDQGIKNLPVAEAARLTQEDPDYGLRDLFNAIAQG
NYPSWTFYIQVMTFKEAETFPFNPFDLTKIWPHQDYPLIPVGKLVLNRNPVNYFAEVEQM
AFDPSNMPPGIEPSPDKMLQGRLFAYPDTHRHRLGPNYLQIPVNCPYRARVANYQRDGPM
CMHDNQGGAPNYYPNSFSAPEQQRSALEHRSQCSTDVQRFNSANEDNVTQVRNFYTKVLN
EEERKRLCENIAGHLKDAQLFIQKKAVKNFTDVHPDYGARIQTLLDKYNAEKPKNAIHTY
TQAGSHLAAKEKANL
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
atgcgatttcttaccccgggtggagacttccagcgcgcccagctgtcctgctcgccacgc
tctgcagctccgaaatcctacaccatggcggacagccgggacccagccagcgaccagatg
aagcactggaaggaacagcggtccttgcagaaacccgatgtcctgaccaccggaggcggg
aacccaataggagataaacttaatatcatgactgctgggtcccgaggaccccttctggtt
caggatgtggttttcactgatgagatggcacattttgacagagagcgaattcccgagaga
gtggtacatgcaaaaggagcaggtgcctttggatactttgaggtcactcatgacattacc
aggtactgtaaggcaaaggtgtttgaacatattggaaagaggactcccattgccgttaga
ttctccacagtcgctggagagtcgggctcagctgacacagttcgtgacccccgtgggttt
gcagtgaaattctacactgaagatggtaactgggatcttgtggggaacaacacccctatt
ttcttcatcagggatgccatattgtttccgtccttcatccatagccagaagagaaaccca
caaactcacctgaaggaccctgacatggtctgggacttctggagcctccgtccagagtcc
ctccatcaggtttccttcttgttcagtgaccgagggattccagatggacatcggcacatg
aatggctacggctcacacacgttcaagctggttaatgcaaacggagaggccgtctattgc
aagttccattacaagaccgaccagggcatcaaaaacttgcctgttgcagaggcggcaaga
cttacccaggaagatcccgattatggcctccgtgatctcttcaatgccattgctcaaggc
aactatccatcctggactttttacatccaagtcatgactttcaaggaggcagaaactttc
ccatttaatccatttgatcttaccaagatttggcctcaccaggactatcctcttatacca
gttggcaaactggtcttaaacagaaacccagttaattactttgctgaagttgaacagatg
gcttttgacccaagcaacatgccccctggcattgagcccagccctgacaaaatgcttcag
ggtcgcctttttgcttatccggacactcaccgccaccgcctggggcccaactatctccag
atacctgtgaactgtccctatcgtgctcgagtggccaactaccagcgggatggccccatg
tgcatgcacgacaatcagggtggtgctccaaactactaccccaacagcttcagcgcacct
gagcagcagcgctcagccctggagcacaggtcccagtgctccacagatgtgcagcgcttc
aacagtgctaatgaagacaacgtcactcaggtgcggaatttctatacgaaggtgttaaat
gaggaggagaggaaacgcctgtgtgagaacattgctggccacctgaaagatgctcagctg
ttcattcagaagaaagctgtcaagaatttcactgacgtccaccctgactacggggcccgc
atccagactcttttggacaaatataatgccgagaagcctaagaacgcgattcatacctat
acgcaggcgggctctcacttggctgcaaaggaaaaagctaacctgtga

DBGET integrated database retrieval system