KEGG   Cricetulus griseus (Chinese hamster): 100774790Help
Entry
100774790         CDS       T02813                                 

Gene name
Sphk2
Definition
(RefSeq) sphingosine kinase 2 isoform X2
  KO
K04718  sphingosine kinase [EC:2.7.1.91]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge00600  Sphingolipid metabolism
cge01100  Metabolic pathways
cge04020  Calcium signaling pathway
cge04071  Sphingolipid signaling pathway
cge04072  Phospholipase D signaling pathway
cge04370  VEGF signaling pathway
cge04371  Apelin signaling pathway
cge04666  Fc gamma R-mediated phagocytosis
cge05152  Tuberculosis
Module
cge_M00100  Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:cge00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    100774790 (Sphk2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    100774790 (Sphk2)
   04371 Apelin signaling pathway
    100774790 (Sphk2)
   04020 Calcium signaling pathway
    100774790 (Sphk2)
   04072 Phospholipase D signaling pathway
    100774790 (Sphk2)
   04071 Sphingolipid signaling pathway
    100774790 (Sphk2)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    100774790 (Sphk2)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100774790 (Sphk2)
Enzymes [BR:cge01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphingosine kinase
     100774790 (Sphk2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAGK_cat
Motif
Other DBs
NCBI-GeneID: 100774790
NCBI-ProteinID: XP_027276387
Position
6
AA seq 620 aa AA seqDB search
MAPPPLLPLASSTPILHGEFGSYPAHGPRFALTLTMQALHIQRLRPKPEARPRDGLVPLA
EVSGCGTLQSRSPSDTAAYFCVYTYPRGRRGGRRRATRTFRVDGAATYEENRAEAQRWAT
ALMCLLRGVPLSGDQEITPELLPRRPRLLILVNPFGGRGLAWQRCMDHVVPMISEAGLSF
NLIQTERQNHARELVQGLSLREWEGIVTVSGDGLLYEAALSLLQVLNGLLDRPDWEDAVR
MPIGVLPCGSGNALAGAVNHYGGFEPAVGVDLLLNCSLLLCRGGSQPLDLLSVTLASGSR
CFSFLSVAWGFLSDVDIHSERFRALGSARFTLGAALGLATLHTYRGRLSYLPATTEPVLP
IPGHSLPRAKSELALAPAPAPTVTHSPLHRSVSDLPLPQPALASPGSPEPLPGLSLNGGG
PELTGDWGGAGDAPLSPDPLLPAPPNSPITAQLSPITEGPPEMPTSSGILPPTSSTPKVS
TWGPVDHLLPPLGSPLPPDWVTIEGEFVLMLAILPSHLCADLVAAPHARFDDGVVHLCWV
RSGISRAALLRILLAMEHGNHFSLGCPHLGYAAARAFRLEPLTPRGVLTVDGELVEYGPM
QAQVHPSLAKLLTGPAGQKQ
NT seq 1863 nt NT seq  +upstreamnt  +downstreamnt
atggccccaccaccactactgcctttggcttccagtactccaatccttcatggcgagttt
ggttcctatccagcccatggcccacggtttgcactcacccttacaatgcaagccctgcac
atacagcggttgcgcccaaagcctgaagcccggccccgagatggcctagtccctctggca
gaggtctcaggctgtggcactctgcagagccgcagcccctcagacactgcagcttacttc
tgcgtctacacctacccacggggccggcgtggaggccggcgcagagctactcgtaccttc
cgggttgatggtgcggccacttacgaggagaatcgtgcagaggcccagcgctgggccact
gccctcatgtgtctccttcgaggagtgcctctgtctggagaccaggaaatcacccctgaa
cttctgccccgtaggcccaggctgctcatattggttaacccttttggggggcgaggcctg
gcctggcagcgctgtatggaccacgtggtgcccatgatctctgaagctgggctgtccttt
aacctcatacagacagaacgacagaaccatgcccgtgaactggtgcaggggttgagccta
cgtgagtgggaaggcattgtcactgtctctggagatgggctgctttatgaggcagccctc
tccctactgcaggtattgaacgggctccttgatcggccagattgggaagatgctgtgcgg
atgcccattggggtcctcccctgcggttccggcaatgcactagctggggcagttaaccac
tatggcggatttgagcctgctgtcggtgttgacctgctgctcaactgttcgctgcttctc
tgccgcggtggcagccagcctctggacctgctctccgtcacgctagcctcaggatcccgc
tgtttttccttcctgtcagtggcctggggattcttgtcagatgtagacatccacagcgag
cgtttcagggccctgggcagcgctagattcaccttgggtgcagcactaggcctggccaca
ttgcatacctaccgcggacgcctctcctacctccctgctaccacagagccagtcttgccc
atcccaggtcacagcctgccacgagccaagtcagaactagctttggccccagccccagcc
cctactgtcacccactcgcccttacatcgctcagtgtctgatctgcccctgccccaacct
gccttggcctccccgggctcccctgaacccctacctggcctttctctcaatggcggcggc
ccagagctgactggagactggggcggagctggggatgcacctctgtccccagacccactg
ctgcccgcaccccccaactccccgataactgctcagctttcacccatcactgaagggccc
ccagaaatgccaacatcctcggggatcctgcctcccacctctagtactccgaaagtctct
acctggggcccagtggaccacctgctccctcccctgggctctccactgcccccagactgg
gtgacaatagaaggggagtttgtactcatgttggctatcttgcccagccacctctgtgca
gacctggtggccgccccacatgctcgatttgatgatggcgtggtgcatctgtgctgggtg
cgcagtggcatttcacgggctgcactactccgtattttgctggccatggagcacggaaac
cacttcagcctgggctgccctcacctgggctatgctgcagctcgtgcctttcgccttgaa
ccactcacgccacgtggtgtgctcactgtggatggggaattagtggagtacgggccaatg
caggcacaggtgcatcccagtcttgccaagctactcactgggcctgcaggtcaaaaacag
tga

DBGET integrated database retrieval system