KEGG   Cricetulus griseus (Chinese hamster): 100774873Help
Entry
100774873         CDS       T02813                                 

Gene name
Bcl2
Definition
(RefSeq) apoptosis regulator Bcl-2 isoform X3
  KO
K02161  apoptosis regulator Bcl-2
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge01521  EGFR tyrosine kinase inhibitor resistance
cge01522  Endocrine resistance
cge01524  Platinum drug resistance
cge04064  NF-kappa B signaling pathway
cge04066  HIF-1 signaling pathway
cge04071  Sphingolipid signaling pathway
cge04115  p53 signaling pathway
cge04140  Autophagy - animal
cge04141  Protein processing in endoplasmic reticulum
cge04151  PI3K-Akt signaling pathway
cge04210  Apoptosis
cge04215  Apoptosis - multiple species
cge04217  Necroptosis
cge04261  Adrenergic signaling in cardiomyocytes
cge04340  Hedgehog signaling pathway
cge04510  Focal adhesion
cge04621  NOD-like receptor signaling pathway
cge04630  Jak-STAT signaling pathway
cge04722  Neurotrophin signaling pathway
cge04725  Cholinergic synapse
cge04915  Estrogen signaling pathway
cge04928  Parathyroid hormone synthesis, secretion and action
cge04933  AGE-RAGE signaling pathway in diabetic complications
cge05014  Amyotrophic lateral sclerosis (ALS)
cge05132  Salmonella infection
cge05145  Toxoplasmosis
cge05152  Tuberculosis
cge05161  Hepatitis B
cge05162  Measles
cge05168  Herpes simplex virus 1 infection
cge05169  Epstein-Barr virus infection
cge05170  Human immunodeficiency virus 1 infection
cge05200  Pathways in cancer
cge05206  MicroRNAs in cancer
cge05210  Colorectal cancer
cge05215  Prostate cancer
cge05222  Small cell lung cancer
cge05226  Gastric cancer
cge05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:cge00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100774873 (Bcl2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    100774873 (Bcl2)
   04630 Jak-STAT signaling pathway
    100774873 (Bcl2)
   04064 NF-kappa B signaling pathway
    100774873 (Bcl2)
   04066 HIF-1 signaling pathway
    100774873 (Bcl2)
   04071 Sphingolipid signaling pathway
    100774873 (Bcl2)
   04151 PI3K-Akt signaling pathway
    100774873 (Bcl2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100774873 (Bcl2)
  09143 Cell growth and death
   04210 Apoptosis
    100774873 (Bcl2)
   04215 Apoptosis - multiple species
    100774873 (Bcl2)
   04217 Necroptosis
    100774873 (Bcl2)
   04115 p53 signaling pathway
    100774873 (Bcl2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100774873 (Bcl2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    100774873 (Bcl2)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    100774873 (Bcl2)
   04928 Parathyroid hormone synthesis, secretion and action
    100774873 (Bcl2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100774873 (Bcl2)
  09156 Nervous system
   04725 Cholinergic synapse
    100774873 (Bcl2)
   04722 Neurotrophin signaling pathway
    100774873 (Bcl2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100774873 (Bcl2)
   05206 MicroRNAs in cancer
    100774873 (Bcl2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100774873 (Bcl2)
   05226 Gastric cancer
    100774873 (Bcl2)
   05215 Prostate cancer
    100774873 (Bcl2)
   05222 Small cell lung cancer
    100774873 (Bcl2)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis (ALS)
    100774873 (Bcl2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100774873 (Bcl2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100774873 (Bcl2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100774873 (Bcl2)
   05152 Tuberculosis
    100774873 (Bcl2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100774873 (Bcl2)
   05162 Measles
    100774873 (Bcl2)
   05161 Hepatitis B
    100774873 (Bcl2)
   05168 Herpes simplex virus 1 infection
    100774873 (Bcl2)
   05169 Epstein-Barr virus infection
    100774873 (Bcl2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100774873 (Bcl2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100774873 (Bcl2)
   01524 Platinum drug resistance
    100774873 (Bcl2)
   01522 Endocrine resistance
    100774873 (Bcl2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:cge01009]
    100774873 (Bcl2)
Protein phosphatases and associated proteins [BR:cge01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100774873 (Bcl2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Bcl-2 BH4 Bcl-2_3
Motif
Other DBs
NCBI-GeneID: 100774873
NCBI-ProteinID: XP_027273662
Position
5
AA seq 298 aa AA seqDB search
MPRGKHQNQVFRVTEDTPSSRNAKAHPIKELDYNYFFFFWGCGAGVRTRSAVDIPAAFFR
GRMAQAGRTGYDNREIVMKYIHYKLSQRGYEWDVGDVDAAPLGAAPTPGIFSFQPESNPT
PAVHRDMAARTSPLRPIVATTGPTLSPVPPVVHLTLRRAGDDFSRRYRRDFAEMSSQLHL
TPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYL
NRHLHTWIQDNGGWDAFVELYGPSVRPLFDFSWLSLKTLLSLALVGACITLGTYLGHK
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgccaagggggaaacaccagaatcaagtgttccgcgtaactgaagacaccccctcatcc
aggaatgcaaaagcacatccaataaaagagctggattataactatttttttttcttttgg
ggctgtggggcgggagtcaggacgagaagtgctgttgatatacctgcagctttttttcgg
ggaaggatggctcaagctgggagaacagggtatgataaccgagagatcgtgatgaagtac
atccattataagctgtcacagaggggctacgagtgggatgtgggagatgtggacgccgcg
cccctgggcgccgcccccacccctggcatcttctccttccagcctgagagcaacccaacg
cccgctgtgcaccgggacatggctgccaggacatcgccactaaggcccatagtcgccacc
actgggcctacccttagccccgtgccacctgtggtccacctgaccctccgccgggctggg
gatgacttctcccgtcgctaccgtcgcgacttcgcggagatgtccagtcagctgcacctg
acgcccttcaccgcgaggggacgctttgctacggtggtggaggaactcttcagggatggg
gtgaactgggggaggattgtggccttctttgagttcggtggggtcatgtgtgtggagagc
gtcaacagggagatgtcacccctggtggacaacatcgccctgtggatgaccgagtacctg
aaccggcatctgcacacctggatccaggataacggaggctgggacgcatttgtggaactg
tacggccccagtgtgaggcctctgtttgatttctcttggctgtctctgaagaccctgctc
agcctggccctggttggggcctgcatcactctgggtacctacctgggccacaagtga

DBGET integrated database retrieval system