KEGG   Cricetulus griseus (Chinese hamster): 103161730
Entry
103161730         CDS       T02813                                 

Gene name
Apln
Definition
(RefSeq) apelin isoform X2
  KO
K05225  apelin
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge04080  Neuroactive ligand-receptor interaction
cge04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    103161730 (Apln)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    103161730 (Apln)
SSDB
Motif
Pfam: Apelin
Other DBs
NCBI-GeneID: 103161730
NCBI-ProteinID: XP_027289314
Position
X
AA seq 77 aa
MNLRLWVQALLLLWLSLTAVCGVPLMLPSDGKGLEEGNMRYLVQPRASRTGPGPWQGGRR
KFRRQRPRLSHKGPMPF
NT seq 234 nt   +upstreamnt  +downstreamnt
atgaatctacgactctgggtgcaggcgctgctcctgctctggctctccttgactgcggtg
tgtggagtgccactgatgctgccttcggatgggaaggggctagaagaaggcaacatgcgc
tacctggtgcagcccagagcttcgaggactggaccagggccctggcagggaggcaggagg
aagttccgcagacagcgcccccgtctctcccataagggtcccatgcctttctga

DBGET integrated database retrieval system