KEGG   Corynebacterium glutamicum SCgG2: C629_04490Help
Entry
C629_04490        CDS       T02691                                 

Definition
(GenBank) hypothetical protein
  KO
K00966  mannose-1-phosphate guanylyltransferase [EC:2.7.7.13]
Organism
cgg  Corynebacterium glutamicum SCgG2
Pathway
cgg00051  Fructose and mannose metabolism
cgg00520  Amino sugar and nucleotide sugar metabolism
cgg01100  Metabolic pathways
cgg01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cgg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    C629_04490
   00520 Amino sugar and nucleotide sugar metabolism
    C629_04490
Enzymes [BR:cgg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     C629_04490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Hexapep Fucokinase DUF4954
Motif
Other DBs
NCBI-ProteinID: AGN21508
Position
957537..958625
Genome map
AA seq 362 aa AA seqDB search
MTLTDNSKNVDAVILVGGKGTRLRPLTVNTPKPMLPTAGHPFLTHLLARIKAAGITHVVL
GTSFKAEVFEEYFGDGSEMGLEIEYVVEDQPLGTGGGIRNVYDKLRYDTAIVFNGDVLSG
ADLSSILDTHREKEADLTMHLVRVANPRAFGCVPTDEDGRVSEFLEKTEDPPTDQINAGC
YVFKKELIEQIPAGRVVSVERETFPQLLEEGKRVFGHVDASYWRDMGTPSDFVRGSADLV
RGIAYSPLLEGKTGESLVDASAGVRDGVLLLGGTVVGRGTEIGAGCRVDNTVIFDGVTIE
PGAVIENSIISSGARIGANAHISGCIIGEGAQVGARCELNAGMRVFPGVVIPDSGIRFSS
DQ
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgactttaactgacaacagcaaaaacgttgatgctgtcatcttggtcggtggcaaaggt
acccgactgcgccccctgactgtcaatactccaaagccaatgctgccaactgctggccac
ccatttttgacccaccttttggcccgcatcaaggccgcaggcatcacacacgtcgtgctg
ggaacgtcattcaaagctgaagtcttcgaggaatacttcggagatggctccgaaatgggc
ttggaaattgaatatgtcgtcgaggatcagcctttgggcactggtggtggcatccgaaac
gtctacgacaagctgcgttatgatactgcgattgtgttcaacggcgatgtgctctccggt
gcggatctcagtagcatcctggacacccaccgcgaaaaagaagcggatctgaccatgcat
ctcgtgcgcgtggccaacccccgcgcgttcggttgcgtccccaccgatgaggatggtcgc
gtcagcgaattccttgaaaagaccgaagatccaccaacagaccagatcaacgccggctgc
tacgtgttcaagaaggaactcatcgagcagatccccgctggccgtgtcgtttccgtcgag
cgcgaaaccttccctcagctgttggaagaaggcaagcgagtcttcggccacgtcgacgcc
tcctactggcgcgacatgggcaccccaagcgacttcgtccgcggctcggctgacctggtc
cgcggcattgcgtactccccattgctcgaaggcaaaacaggagagtcgcttgtcgacgcc
tccgccggcgttcgcgacggcgtcctgctgctcggcggcaccgtagtcggccgcggcacc
gagatcggtgccggctgccgcgttgacaacaccgttattttcgacggcgtcaccattgaa
ccaggtgcggtcattgaaaattccatcatttcctcgggagcacgcatcggtgctaatgca
cacatctccggttgcatcatcggtgagggcgcacaggttggtgctcggtgtgaactcaac
gcagggatgcgtgtcttcccaggcgttgtgatcccagacagcggaattcgtttttcgtct
gatcagtag

DBGET integrated database retrieval system