KEGG   Corynebacterium glutamicum SCgG2: C629_05760Help
Entry
C629_05760        CDS       T02691                                 

Definition
(GenBank) mycothiol conjugate amidase Mca
  KO
K18455  mycothiol S-conjugate amidase [EC:3.5.1.115]
Organism
cgg  Corynebacterium glutamicum SCgG2
Brite
KEGG Orthology (KO) [BR:cgg00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    C629_05760
Enzymes [BR:cgg01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.115  mycothiol S-conjugate amidase
     C629_05760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PIG-L
Motif
Other DBs
NCBI-ProteinID: AGN21758
Position
1230628..1231503
Genome map
AA seq 291 aa AA seqDB search
MSGLRLMAIHAHPDDESSKGAATMARYAAEGNQVMVVTCTGGERGDILNPAMDKPGILDN
IFAVRQEEMAKAMEILGTEHRWLGYEDSGLPQGDPLPPLPEGCFALEDSDKVTRDLVKIL
REFRPHVLITYDENGGYPHPDHLKVHEVSMLAWEKSGDAAYAPELGAPWEPLKLYYTHGF
IRQRMEMFHDLLIEQGKPSPYTPMLERWKANEADVMARVTTQVPCERFFDQRDDALRAHA
TQIDPAGAFFGTPVEVQRRLWPTEEFELAKTRVKTSIPEDDLFAGITPDAE
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
gtgagtggtctacgcctaatggcgatccacgcccaccctgacgacgagtcaagcaagggc
gcagcaaccatggcgcgctatgcagctgagggcaatcaagtaatggttgtcacctgcacc
ggtggtgagcgtggagacattctcaaccctgctatggataagccaggaatcctggacaat
atttttgctgtgcgtcaggaagagatggcgaaggccatggaaattcttggcactgagcac
agatggctaggttatgaggactctgggctgccccaaggtgatcctttgcctcctctgcct
gagggctgttttgctttagaagactcggataaagtcacccgagatttagtgaagattctg
cgcgagttccgcccacacgtcctcattacctatgatgagaacggcggttacccacacccg
gatcacctcaaggttcatgaggtgtcgatgcttgcatgggagaagtccggcgatgcagcg
tatgcacctgagttgggcgcaccgtgggagccactgaagctttattacacccacggcttt
atccgtcaacgcatggaaatgttccatgatctgctcattgaacagggcaagcccagccca
tacaccccgatgcttgagcgttggaaggcaaatgaggctgatgtgatggctcgagttacc
actcaggttccttgtgagcgcttctttgatcagcgtgatgacgccctgcgtgcgcacgca
actcagattgatcctgcgggtgctttctttggaactcccgttgaggtgcagcgtcgcctg
tggccgactgaagagttcgaattagctaaaactcgtgtgaagacgtcgatcccagaagat
gacttgtttgccggaatcacacccgatgcagaataa

DBGET integrated database retrieval system