KEGG   Corynebacterium glutamicum SCgG2: C629_08060Help
Entry
C629_08060        CDS       T02691                                 

Definition
(GenBank) 6-phosphogluconate dehydrogenase
  KO
K00033  6-phosphogluconate dehydrogenase [EC:1.1.1.44 1.1.1.343]
Organism
cgg  Corynebacterium glutamicum SCgG2
Pathway
cgg00030  Pentose phosphate pathway
cgg00480  Glutathione metabolism
cgg01100  Metabolic pathways
cgg01110  Biosynthesis of secondary metabolites
cgg01120  Microbial metabolism in diverse environments
cgg01130  Biosynthesis of antibiotics
cgg01200  Carbon metabolism
Module
cgg_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
cgg_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:cgg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    C629_08060
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    C629_08060
Enzymes [BR:cgg01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.44  phosphogluconate dehydrogenase (NADP+-dependent, decarboxylating)
     C629_08060
    1.1.1.343  phosphogluconate dehydrogenase (NAD+-dependent, decarboxylating)
     C629_08060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 6PGD NAD_binding_2 F420_oxidored 3HCDH_N NAD_binding_11 Shikimate_DH ApbA NAD_Gly3P_dh_N 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: AGN22212
Position
complement(1722067..1723521)
Genome map
AA seq 484 aa AA seqDB search
MTNGDNLAQIGVVGLAVMGSNLARNFARNGNTVAVYNRSTDKTDKLIADHGSEGNFIPSA
TVEEFVASLEKPRRAIIMVQAGNATDAVINQLADAMDEGDIIIDGGNALYTDTIRREKEI
SARGLHFVGAGISGGEEGALNGPSIMPGGPAKSYESLGPLLESIAANVDGTPCVTHIGPD
GAGHFVKMVHNGIEYADMQVIGEAYHLLRYAAGMQPAEIAEVFKEWNAGDLDSYLIEITA
EVLSQVDAETGKPLIDVIVDAAGQKGTGRWTVKAALDLGIATTGIGEAVFARALSGATSQ
RAAAQGNLPGGVLTDLEALGVDKAQFVEDVRRALYASKLVAYAQGFDEIKAGSDENNWDV
DPRDLATIWRGGCIIRAKFLNRIVEAYDANAELESLLLDPYFKSELGDLIDSWRRVIVTA
TQLGLPIPVFASSLSYYDSLRAERLPAALIQGQRDFFGAHTYKRIDKDGSFHTEWSGDRS
EVEA
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgactaatggagataatctcgcacagatcggcgttgtaggcctagcagtaatgggctca
aacctcgcccgcaacttcgcccgcaacggcaacactgtcgctgtctacaaccgcagcact
gacaaaaccgacaagctcatcgccgatcacggctccgaaggcaacttcatcccttccgca
actgtcgaagagttcgtagcatccctggaaaagccacgccgcgccatcatcatggttcag
gctggtaacgccaccgacgcagtcatcaaccagctggcagacgccatggacgaaggcgac
atcatcatcgacggcggcaacgccctctacaccgacaccattcgtcgcgagaaggaaatc
tccgcacgcggtctccacttcgtcggtgctggtatctccggcggcgaagaaggcgcactc
aacggcccatccatcatgcctggcggcccagcaaagtcctacgagtccctcggaccactg
cttgagtccatcgctgccaacgttgacggcaccccatgtgtcacccacatcggcccagac
ggcgccggccacttcgtcaagatggtccacaacggcatcgagtacgccgacatgcaggtc
atcggcgaggcataccaccttctccgctacgcagcaggcatgcagccagctgaaatcgct
gaggttttcaaggaatggaacgcaggcgacctggattcctacctcatcgaaatcaccgca
gaggttctctcccaggtggatgctgaaaccggcaagccactgatcgacgtcatcgttgac
gctgcaggccagaagggcaccggccgctggaccgtcaaggctgctcttgatctgggtatt
gctaccaccggcatcggcgaagctgttttcgcacgtgcactctccggcgcaaccagccag
cgcgctgcagcacagggcaacctacctggaggtgtcctcaccgatctggaagcacttggc
gtggacaaggcacagttcgtcgaagacgttcgccgtgcactgtacgcatccaagcttgtt
gcttacgcacagggcttcgacgagatcaaggctggctccgacgagaacaactgggatgtt
gaccctcgcgacctcgctaccatctggcgcggcggctgcatcattcgcgctaagttcctc
aaccgcatcgtcgaagcatacgatgcaaacgctgaacttgagtccctgctgctcgatcct
tacttcaagagcgagctcggcgacctcatcgattcatggcgtcgcgtgattgtcactgcc
acccagcttggcctgccaatcccagtgttcgcttcctccttgtcctactacgacagcctg
cgtgcagagcgtctgccagcagccctgatccagggacagcgcgacttcttcggtgcgcac
acttacaagcgcatcgacaaggatggctccttccacaccgagtggtccggcgaccgctcc
gaggtggaagcttaa

DBGET integrated database retrieval system