KEGG   Corynebacterium glutamicum SCgG2: C629_11315Help
Entry
C629_11315        CDS       T02691                                 

Definition
(GenBank) hypothetical protein
  KO
K01792  glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
cgg  Corynebacterium glutamicum SCgG2
Pathway
cgg00010  Glycolysis / Gluconeogenesis
cgg01100  Metabolic pathways
cgg01110  Biosynthesis of secondary metabolites
cgg01120  Microbial metabolism in diverse environments
cgg01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:cgg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    C629_11315
Enzymes [BR:cgg01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     C629_11315
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: AGN22857
Position
2451219..2451986
Genome map
AA seq 255 aa AA seqDB search
MTTFITSGGLEISPAGAHIVHAESPEGELLFVSSASRYGEGNAIRGGVPIIAPWFGGLLG
LDPAHGWARRSAWDVTEHDGQIHAEYGREGLLLDIRANSTKNGFEITLRAYNDTDEARTV
QLAFHPYFKVDDVEKIEVRGLDGVDILNRLNDEVETQDGPITFDGEFDRIALGTPVVRIF
DTDRIITIEGDGHDSTVVWNPGESRASTVADIGEGEWRDFVCVEPALLGADQKGVRVAPG
QSVTVGMQVSVEKRA
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgactacttttattacctccggtggcttggaaatctcccccgctggcgctcatattgtt
cacgccgaatcacctgaaggtgagctgttgtttgttagctccgcttcccgatatggggag
ggaaatgcaattaggggtggtgtgcccatcattgctccgtggtttggtggactgcttggt
ttggaccctgcacatggttgggcgaggcgttccgcgtgggacgtgactgaacatgacggc
caaattcacgctgaatatggccgcgagggtttactgctggatattcgtgcgaacagcact
aagaatggttttgagatcaccctgcgcgcttacaacgacaccgatgaggcacgcactgtg
cagttggccttccatccctatttcaaggtggatgatgtagaaaagatcgaagtccgtggc
cttgatggggtggacattctcaatcgcctgaacgatgaggtggagacccaagatggtccc
attacttttgatggcgagttcgatcgcattgcgctagggactccggttgtgaggattttt
gataccgatcgcatcatcactattgagggcgatggtcatgattccactgtggtgtggaat
ccaggcgaaagtcgcgcctccaccgtggccgatattggcgaaggtgaatggcgcgacttt
gtgtgtgttgaaccggcgcttttgggtgctgaccaaaaaggagtgagggtggctccgggg
cagtcagtcaccgttgggatgcaggtaagcgtcgaaaagcgtgcttag

DBGET integrated database retrieval system