KEGG   Corynebacterium glutamicum SCgG2: C629_12615Help
Entry
C629_12615        CDS       T02691                                 

Definition
(GenBank) succinate CoA transferase
  KO
K18118  succinyl-CoA:acetate CoA-transferase [EC:2.8.3.18]
Organism
cgg  Corynebacterium glutamicum SCgG2
Pathway
cgg00020  Citrate cycle (TCA cycle)
cgg00620  Pyruvate metabolism
cgg00650  Butanoate metabolism
cgg01100  Metabolic pathways
cgg01110  Biosynthesis of secondary metabolites
cgg01120  Microbial metabolism in diverse environments
cgg01130  Biosynthesis of antibiotics
cgg01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cgg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    C629_12615
   00620 Pyruvate metabolism
    C629_12615
   00650 Butanoate metabolism
    C629_12615
Enzymes [BR:cgg01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.18  succinyl-CoA:acetate CoA-transferase
     C629_12615
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetylCoA_hyd_C AcetylCoA_hydro CoA_trans Phage_rep_org_N
Motif
Other DBs
NCBI-ProteinID: AGN23113
Position
complement(2748075..2749583)
Genome map
AA seq 502 aa AA seqDB search
MSDRIASEKLRSKLMSADEAAQFVNHGDKVGFSGFTGAGYPKALPTAIANRAKEAHGAGN
DYAIDLFTGASTAPDCDGVLAEADAIRWRMPYASDPIMRNKINSGSMGYSDIHLSHSGQQ
VEEGFFGQLNVAVIEVTRITEEGYIIPSSSVGNNVEWLNAAEKVILEVNSWQSEDLEGMH
DIWSVPALPNRIAVPINKPGDRIGKTYIEFDTDKVVAVVETNTADRNAPFKPVDDISKKI
AGNFLDFLESEVAAGRLSYDGYIMQSGVGNVPNAVMAGLLESKFENIQAYTEVIQDGMVD
LIDAGKMTVASATSFSLSPEYAEKMNNEAKRYRESIILRPQQISNHPEVIRRVGLIATNG
LIEADIYGNVNSTNVSGSRVMNGIGGSGDFTRNGYISSFITPSEAKGGAISAIVPFASHI
DHTEHDVMVVISEFGYADLRGLAPRERVAKMIGLAHPDYRPLLEEYYARATSGDNKYMQT
PHDLATAFDFHINLAKHGSMKA
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgtctgatcgcattgcttcagaaaagctgcgctccaagctcatgtccgccgacgaggcg
gcacagtttgttaaccacggtgacaaggtcggtttctccggcttcaccggcgctggctac
ccaaaggcactgcctacggcaatcgctaaccgggctaaggaagcacacggtgcaggcaac
gactacgcaattgacctgttcactggcgcatccaccgcacctgactgcgatggcgtactt
gcagaagctgatgctatccgctggcgcatgccatacgcatctgatccaatcatgcgtaac
aagatcaactccggctccatgggatactccgatatccacctgtcccactccggccagcag
gtcgaagagggcttcttcggccagctcaacgtagctgtcattgaagtcacccgcattacc
gaagagggctacatcattccttcttcctccgtgggtaacaacgttgagtggctcaacgct
gccgagaaggtcatcctcgaggttaactcttggcagtctgaagacctcgaaggtatgcac
gacatctggtctgttcctgccctgccaaaccgcattgcagtgccaatcaacaagccaggc
gaccgcatcggtaagacctacatcgagttcgacaccgacaaggttgttgctgttgttgag
accaacactgcagaccgcaacgcaccattcaagcctgtcgacgacatctctaagaagatc
gctggcaacttcctcgacttcctggagagcgaagttgctgcaggtcgcctctcctacgac
ggctacatcatgcagtccggcgtgggcaacgtgcctaacgctgtgatggcaggtctgctg
gaatccaagtttgagaacatccaggcctacaccgaagttatccaggacggcatggtcgac
ctcatcgacgccggcaagatgaccgttgcatccgcaacctctttctccctgtcccctgag
tacgcagagaagatgaacaacgaggctaagcgttaccgcgagtccatcatcctgcgccca
cagcagatctctaaccatccagaggtcatccgccgcgtcggcctgatcgccaccaacggt
ctcatcgaggctgacatttacggcaacgtcaactccaccaacgtttccggctcccgcgtc
atgaacggcatcggcggttccggcgacttcacccgtaatggctacatctccagcttcatc
accccttcagaggcaaagggcggcgcaatctctgcgatcgttcctttcgcatcccacatc
gaccacaccgagcacgatgtcatggttgttatctctgagttcggttacgcagaccttcgt
ggtctggctccacgtgagcgcgtcgctaagatgatcggcctggcacaccctgattaccgc
ccactgctcgaggagtactacgctcgagcaacctccggtgacaacaagtacatgcagacc
cctcatgatcttgcaaccgcgtttgatttccatatcaacctggctaagcacggctccatg
aaggcataa

DBGET integrated database retrieval system