KEGG   Corynebacterium glutamicum SCgG2: C629_12730Help
Entry
C629_12730        CDS       T02691                                 

Definition
(GenBank) hypothetical protein
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
cgg  Corynebacterium glutamicum SCgG2
Pathway
cgg00480  Glutathione metabolism
cgg00590  Arachidonic acid metabolism
cgg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cgg00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    C629_12730
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    C629_12730
Enzymes [BR:cgg01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     C629_12730
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: AGN23136
Position
complement(2773647..2774126)
Genome map
AA seq 159 aa AA seqDB search
MTSIHDISVTLNDGTETTMADWAGHLLLIVNVASKCGLTPQYEGLQKLYEEYQDRGFFVI
GVPCNQFNGQEPGTDAEVCAFAQNQYDVTFPLLSKTEVNGEGTHPLYKVLKETTGGSEIE
WNFEKFLVDAEGNTIKRFAPRTEPSAAEVVEAIEENLPI
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
gtgacttctattcatgacatcagcgtaactctcaacgacggcacagaaaccaccatggcg
gattgggcgggccaccttttgctcatcgtgaacgtggcttccaagtgcggactcacgcca
cagtatgaagggcttcagaaactgtatgaggagtaccaagatcgaggcttctttgtcatt
ggcgtaccttgtaatcaattcaacggccaggagccaggaaccgacgctgaagtgtgtgct
ttcgcgcaaaatcagtacgacgtcaccttcccgctcttgagcaaaaccgaggtgaatggg
gagggtacccaccccctgtacaaggtgctcaaagagacaactggtggtagtgaaatcgag
tggaattttgagaaattcctggtagatgcggaaggtaacacgattaagcgctttgctcct
cggacggaaccatctgcagctgaggtagtggaagcaatcgaggagaatctccctatctaa

DBGET integrated database retrieval system