KEGG   Corynebacterium glutamicum SCgG2: C629_15110Help
Entry
C629_15110        CDS       T02691                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
cgg  Corynebacterium glutamicum SCgG2
Pathway
cgg00071  Fatty acid degradation
cgg00072  Synthesis and degradation of ketone bodies
cgg00280  Valine, leucine and isoleucine degradation
cgg00310  Lysine degradation
cgg00362  Benzoate degradation
cgg00380  Tryptophan metabolism
cgg00620  Pyruvate metabolism
cgg00630  Glyoxylate and dicarboxylate metabolism
cgg00640  Propanoate metabolism
cgg00650  Butanoate metabolism
cgg00900  Terpenoid backbone biosynthesis
cgg01100  Metabolic pathways
cgg01110  Biosynthesis of secondary metabolites
cgg01120  Microbial metabolism in diverse environments
cgg01130  Biosynthesis of antibiotics
cgg01200  Carbon metabolism
cgg01212  Fatty acid metabolism
cgg02020  Two-component system
Brite
KEGG Orthology (KO) [BR:cgg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    C629_15110
   00630 Glyoxylate and dicarboxylate metabolism
    C629_15110
   00640 Propanoate metabolism
    C629_15110
   00650 Butanoate metabolism
    C629_15110
  09103 Lipid metabolism
   00071 Fatty acid degradation
    C629_15110
   00072 Synthesis and degradation of ketone bodies
    C629_15110
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    C629_15110
   00310 Lysine degradation
    C629_15110
   00380 Tryptophan metabolism
    C629_15110
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    C629_15110
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    C629_15110
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    C629_15110
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cgg04147]
    C629_15110
Enzymes [BR:cgg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     C629_15110
Exosome [BR:cgg04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   C629_15110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AGN23608
Position
3317543..3318772
Genome map
AA seq 409 aa AA seqDB search
MSSVKDNDAVIVSIARSPIGRAKKGSLTTLRADDMAAQMVDAALKQVPELDTHDIYDLMM
GCGQPGGEAGFNIGRIVTEILGLDWIPATTVQRYCASSLQTSRMAFHAIKAGEGDAFISA
GVEAVSRFDRGTSDSWPNTKNPRFNSAAKVTQRIAASEQNWVDPRENGNLPDAYISMGQT
AENVAQYLRISREEQDEWAVLSQNRAEEAIKAGFFEREITPLTLPDGTVVAKDDGPRFGT
TIEKVQGLKSVFRENGTVTAANACPLNDGAAAAVIVSGAKAKSLGLKPLARIVSTGVSSL
SAEIMGLGPIKASQQALKHAGMSMEDIDLVEINEAFASQVIGCARELEIPVNKLNIHGGA
IALGHPFGMTGVRITATLLNGLQSTDQQFGLETMCTAGGQGMAMVLERL
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgagctccgttaaagataacgatgccgtaattgtatccatagccaggtcaccaattggc
cgagcaaagaaagggtcattaactactcttcgagccgatgacatggcggctcaaatggta
gatgcggctctcaaacaggtacctgaactagatacccatgacatctatgacctgatgatg
ggctgtgggcaacccggcggcgaagcaggatttaacattgggcgcatagttacagaaatt
ctcggtctcgattggataccagcaactacagttcagcgttactgtgcatcttcactacag
accagcagaatggcatttcacgcaattaaggcaggcgagggagatgcgtttatttctgcc
ggtgtggaagccgtctctcgctttgaccgtggtacctcagattcttggccaaatactaag
aacccgaggtttaactcggctgccaaggtcacacaacgcattgcggcgagtgagcagaac
tgggtagacccacgtgaaaatggcaatctacctgatgcatatatttctatgggtcaaact
gctgaaaatgtggcgcagtatctgaggatcagccgtgaagaacaagatgaatgggccgtc
ctaagtcagaatcgtgcggaggaggccatcaaagcagggttctttgaacgtgaaatcaca
ccattgacattgcctgatggcaccgttgtggcaaaagatgatggaccgcgctttggaaca
accattgaaaaggtgcaaggactcaagtctgttttccgcgaaaatggcactgtaactgct
gcaaatgcttgtccgctcaatgacggtgcggctgctgccgtgattgttagtggagcaaaa
gccaagagcctgggtctgaaaccgctagcgagaatcgtctcaacaggcgtatctagtctt
tccgcagagatcatgggacttgggccaatcaaggcatctcaacaagcgctcaaacatgca
ggtatgtcaatggaagacatcgatctcgttgaaatcaatgaagcctttgcgtcacaagta
attggatgcgcacgagagctagaaatcccagtaaacaagctcaatattcatggaggagca
atcgcacttggccatccatttggaatgactggagtccgaattactgcgaccctactcaat
ggtctgcagtcgactgaccagcagtttggactagagacaatgtgtacagcaggaggacag
ggcatggccatggttctagaaagactctaa

DBGET integrated database retrieval system