KEGG   Capnocytophaga gingivalis: CGC50_10480Help
Entry
CGC50_10480       CDS       T05260                                 

Definition
(GenBank) phosphatidylserine decarboxylase family protein
  KO
K01613  phosphatidylserine decarboxylase [EC:4.1.1.65]
Organism
cgh  Capnocytophaga gingivalis
Pathway
cgh00564  Glycerophospholipid metabolism
cgh01100  Metabolic pathways
cgh01110  Biosynthesis of secondary metabolites
Module
cgh_M00093  Phosphatidylethanolamine (PE) biosynthesis, PA => PS => PE
Brite
KEGG Orthology (KO) [BR:cgh00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    CGC50_10480
Enzymes [BR:cgh01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.65  phosphatidylserine decarboxylase
     CGC50_10480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PS_Dcarbxylase DUF4131 DUF202
Motif
Other DBs
NCBI-ProteinID: ATA87535
UniProt: A0A250FT06
Position
2199813..2200472
Genome map
AA seq 219 aa AA seqDB search
MFYKPHKEGVKIIFGSTAMVALFLILIDQFVTIEWLRVTLMLVVLAFYILILQFFRNPKR
ETPINPNHIISSVDGKVVVIEEVEENEYFKDKRRMVSVFMSPLNVHVTRYPMSGEVVYSK
YHPGKYLVAWHPKASEENERTTVVVENTQFGKVLYRQIAGALAKRIVNYAKEGDQAVQGE
DAGFIKFGSRVDIYLPLSAKIKVTLGQKVKGGIDIIAEV
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgttttataaaccacacaaagaaggtgtaaaaattatctttgggagtacagctatggtg
gctttattccttatacttatagatcagtttgtcacaatagagtggcttagggtaacacta
atgctggttgtcttagccttctatatactaattttacaatttttcaggaatcctaagcga
gagacacctatcaatcctaaccatatcatctcctcggtagatgggaaggtggtagtgata
gaagaagtagaagagaatgaatacttcaaggacaagcgtaggatggtttccgtattcatg
tcgcccctgaatgtacatgtaacccgctatccgatgagtggagaggtagtctatagtaag
tatcatcctgggaaatacttagtagcatggcaccctaaagcctctgaggagaacgagcgc
actacagtagtggtagaaaatacccaattcggtaaggtactctatcgacagatagcaggc
gctttggctaagcgtatagtcaactatgccaaagaaggagatcaagcagtacaaggggaa
gatgctggttttatcaagtttggctcccgagtagacatttacctacctctatcggcaaaa
atcaaggttacccttggtcagaaagtcaaaggagggatagacatcatagcagaggtatag

DBGET integrated database retrieval system