KEGG   Cryptococcus gattii: CGB_B0490CHelp
Entry
CGB_B0490C        CDS       T02232                                 

Definition
(RefSeq) fructose-bisphosphatase
  KO
K03841  fructose-1,6-bisphosphatase I [EC:3.1.3.11]
Organism
cgi  Cryptococcus gattii
Pathway
cgi00010  Glycolysis / Gluconeogenesis
cgi00030  Pentose phosphate pathway
cgi00051  Fructose and mannose metabolism
cgi00680  Methane metabolism
cgi01100  Metabolic pathways
cgi01110  Biosynthesis of secondary metabolites
cgi01130  Biosynthesis of antibiotics
cgi01200  Carbon metabolism
Module
cgi_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
cgi_M00344  Formaldehyde assimilation, xylulose monophosphate pathway
Brite
KEGG Orthology (KO) [BR:cgi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CGB_B0490C
   00030 Pentose phosphate pathway
    CGB_B0490C
   00051 Fructose and mannose metabolism
    CGB_B0490C
  09102 Energy metabolism
   00680 Methane metabolism
    CGB_B0490C
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cgi04147]
    CGB_B0490C
Enzymes [BR:cgi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     CGB_B0490C
Exosome [BR:cgi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CGB_B0490C
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase Inositol_P
Motif
Other DBs
NCBI-GeneID: 10188905
NCBI-ProteinID: XP_003191893
UniProt: E6QZT7
Position
B:complement(join(133703..134161,134217..134357,134412..134496,134550..134770,134865..135011))
Genome map
AA seq 350 aa AA seqDB search
MAAPQATLGADLEPPATDLITLTRHILSQQYALGESATGDLTMLLIAIQVTSKYIASNVR
KARLINLVGLAGASNVQGEDQKKLDVLSNDIMVNALSASGKCSVMVSEEVDEAIIVGGNK
GTYCVVFDPLDGSSNIDAGVNVGTIFGVYKVQDGSKGSVKDVLRPGREMVAAGYTMYGSS
CNLVLSTGNGVDGFTLDESLGEFILTHPAIKIPSRGKIYSFNEGNSLHFHPPTNDYLNSI
KYPENGKPYSARYIGSMVADVHRTLLYGGIFGYPDDKKSKDGKLRMLYEAFPMSFLTEQA
GGVATTGSQRILDIVPTSIHGRCPVFLGSKEDVEDLKKFYAGYKDDSRKW
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atggccgccccacaagctactctcggtgccgatcttgagccccctgcgactgacttgatc
acccttaccaggcatatcttgtctcaacaatatgctttgggtgagagcgctactggcgac
cttaccatgcttttgatcgccatccaggtgacttccaaatacatcgcctccaacgtccga
aaagctcgtctgatcaacctcgttggtcttgccggtgcttccaacgtccagggcgaggac
cagaaaaagctcgatgtgctttcaaatgacatcatggtcaatgctttgagcgccagtgga
aagtgctcagtcatggttagtgaggaggttgacgaagctatcattgttggtggaaacaag
ggtacctactgtgttgttttcgaccctctcgacggctctagtaacattgatgctggtgtt
aacgtcggtaccattttcggtgtctacaaggtgcaagatggttctaagggctctgttaag
gacgttcttcgtcccggtagggaaatggtcgctgctggttacaccatgtacggttcttcg
tgtaaccttgttttgtccaccggtaacggtgttgacggtttcaccctcgacgagtccctc
ggagagttcatccttacccacccagccatcaaaatcccctctcgaggcaagatctactca
ttcaacgaaggaaactctttgcacttccacccccctaccaacgactacctcaacagcatc
aagtaccctgagaatggcaagccttactctgcgaggtacatcggttccatggttgccgat
gttcaccgaacgttgttgtacggcggtatctttggctaccctgatgacaagaagagcaag
gatggtaaattgaggatgctttacgaggccttccctatgtctttcctcaccgagcaggct
ggcggtgttgccactactggctctcaacgtattctcgacattgtccccacctctattcac
ggccgatgcccagtcttcttgggtagtaaggaggatgtagaggatttgaagaagttctat
gccggttacaaggatgactctaggaagtggtaa

DBGET integrated database retrieval system