KEGG   Cryptococcus gattii: CGB_B1300C
Entry
CGB_B1300C        CDS       T02232                                 

Definition
(RefSeq) C-14 sterol reductase
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
cgi  Cryptococcus gattii
Pathway
cgi00100  Steroid biosynthesis
cgi01100  Metabolic pathways
cgi01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cgi00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    CGB_B1300C
Enzymes [BR:cgi01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     CGB_B1300C
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295 PEMT ICMT
Other DBs
NCBI-GeneID: 10186895
NCBI-ProteinID: XP_003191982
UniProt: E6R000
Position
B:complement(join(295700..295705,295790..295828,295982..296120,296210..296235,296298..296371,296456..296912,296986..297203,297289..297709))
AA seq 459 aa
MSDQEESTTTVITATTHLDLPAHPHIKTYQELNPRSKPTEFFGPWGTGAITLFTPLFTYF
FFFACNDAVGCTPTSVQGWKDALALVGNYPSSAGKLWEWKAVGVYLAWYAFCMICEVVLP
GQRVQGNLLRDGRRKVYRMNGLYTLLLALGLLTGVLVQPKGIQAFTWLHDHFVPLISASL
AMATFQAVWVYVWSFFSGGLLALGGNSGNVIYDFFIGRPLNPTIPGFSSFDLKTFNEVRP
GMILWLLLNISCACEQYVRIGKLTDSMWIVLIFEGWYVLDCLVQEHTILNQMDITTDGFG
FMLAFGDLTWVPFTYGLQARFLASNPVELGPVATALIVGVEVAGMYIFRVANNEKANFRA
GKNPKNLEYMQTERGTKLLTSGWWGRSQHPNYFGDWLIALGWCLPTGFNTPLTYFYLVYF
VVLLLHRQKRDEEACKLKYGKDWERYCEKVPYKIIPYVY
NT seq 1380 nt   +upstreamnt  +downstreamnt
atgtccgaccaggaagaatccacaacaacggtcataacagctacaacccacctagatctc
cccgcccacccacacatcaagacctaccaggagcttaacccccgctcaaagcccacagag
ttcttcgggccatggggcacaggcgcaatcaccctcttcactcctctcttcacctacttt
ttcttctttgcttgcaatgacgctgtcggatgcacaccaactagtgtccagggctggaaa
gatgctttggcgctggtgggcaactacccgagctccgcaggtaaattgtgggagtggaaa
gccgtgggagtgtatctcgcctggtatgcgttttgcatgatctgtgaagtcgtcttgcct
gggcaaagagtccaaggtaacttgttgcgagatggtcgaagaaaagtctacagaatgaac
ggtctttacactcttctcctcgcccttggtcttcttaccggcgttcttgtccagcccaag
ggtattcaagctttcacttggcttcatgaccactttgtgcccctcatttcggccagttta
gccatggccactttccaagccgtctgggtttatgtgtggagctttttctctggtgggctc
ttggctcttggtggaaactctggtaatgtcatttacgacttctttatcggccgacctctt
aaccctaccatccccggattctcctctttcgacctcaagacattcaacgaagttcgaccc
ggcatgatcctctggctcttactcaacatttcttgcgcttgcgagcaatatgtcaggatt
gggaaattgactgatagtatgtggatcgtcctcatctttgagggctggtacgtcctcgac
tgtcttgtgcaagaacacacaatcctcaaccagatggacattacaaccgacggtttcggc
tttatgctcgcctttggcgacctcacctgggttccttttacgtacggtctccaagcacgg
ttcttggcttctaaccccgtcgagctgggtcccgtggcgacagcgttgatcgtcggtgtt
gaggtcgcggggatgtacatcttccgagtggctaataatgaaaaggccaatttcagagct
ggaaagaaccccaagaacttggaatacatgcagacagagaggggtaccaagcttttgact
tccggctggtggggccgatctcaacatcctaactactttggcgactggctcattgctcta
ggatggtgtcttcccaccggcttcaacacccccctcacatatttttacctcgtctatttt
gttgttctccttttgcacaggcaaaagagggatgaagaggcttgtaaactcaagtatggc
aaagactgggaacgttattgcgaaaaagtgccttacaagattatcccttacgtctattaa

DBGET integrated database retrieval system