KEGG   Cryptococcus gattii: CGB_B9070WHelp
Entry
CGB_B9070W        CDS       T02232                                 

Definition
(RefSeq) hypothetical protein
  KO
K02365  separase [EC:3.4.22.49]
Organism
cgi  Cryptococcus gattii
Pathway
cgi04111  Cell cycle - yeast
cgi04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:cgi00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    CGB_B9070W
   04113 Meiosis - yeast
    CGB_B9070W
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:cgi01002]
    CGB_B9070W
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cgi03036]
    CGB_B9070W
Enzymes [BR:cgi01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.49  separase
     CGB_B9070W
Peptidases and inhibitors [BR:cgi01002]
 Cysteine peptidases
  Family C50: separase family
   CGB_B9070W
Chromosome and associated proteins [BR:cgi03036]
 Eukaryotic type
  Sister chromatid separation proteins
   Separase
    CGB_B9070W
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RPN7
Motif
Other DBs
NCBI-GeneID: 10187919
NCBI-ProteinID: XP_003192413
UniProt: E6R1D2
Position
B:join(1988412..1988718,1988785..1989008,1989050..1990378,1990441..1991207,1991262..1991578,1991813..1991917,1991976..1992168,1992221..1992377,1992440..1992931,1992995..1993152,1993245..1993333,1993387..1993535)
Genome map
AA seq 1428 aa AA seqDB search
MPPRTTGQRAALAARNVPMRTSARSGTQVPTAADELVDGINKLAVSKPEPKVRLTRTKPS
SSKAASSISTKAINERPATANAANRKEKATFEDLLPWACSTAALGESENSGYRYGSFNVS
NEGSEWTDEKVVRLVDTCQVAFRVLRELDEQGMIGDKGAEVERTCQGVVTKCLNMGMVHK
AMEVLVEARPALLRLYKAMNVEASKITAIKVPTTSRATSSSRSTVGVASKTATTTSRSTP
ATSRSTRPTSVAESAKSSLKSGRKASVPSRWLELAWFPAPMEGTEMSEPVKNLLFMAMVS
AWTGLIATSKGSEEVLAMMPATPDSAKLNPLALGLTLPLTSITPPLYCLYRAIDTLNLPS
TSSLNIRYRQIALFALSMTICSSAHSRNSPTRLWEAAHRAISTYVQVQNSSEDLSEAAQV
IKKLVDWVESMVGKRGENVKDWLSGKGWLGLMEIWIALGRRLDDVNIIDKALSLMASSSS
ISTPPSTALSTEEPVSWTLTGSPEVEVARIRGDLAKASLMFDKIFSGRSLPTPDQQCIDA
LSLEDLNVLGQAVNTLPNDEESNVLIDRVVRAWERVRRGCVKIIDRYGTEESCKMLVGLV
ERWSRAALDFVENVAGRIEINPFLADYLITGIIDTICFLSQRHLSSSSILLPRGYELHRR
VKGSTKVVDQIDWLRALSIAASNIGGRLFSQSRMEAAVHLASLSCGWAVEVGNLVKVEEM
DEEGDKKVQQLSEGLAKRWEFLASCYQRHGQKKEVFSAYIQCLAYQPPSLLSKLTRAASQ
PISKIFEPFTDFQNSLLRLSAFILYDPTLCSDFGISLMKEMTTNSYKPHEVGAIGEKMMD
TLEDGAWKEEVARIVLDLGEGLLDVYGTEFPIRRLRVVTRMMRIIVSSGQRMPRFDRLVE
DADHLFAQTNLGHDISLGQYKKEHYAYTLILRALRAYHFEGDPTPAVLKNHKQAMEALHE
VLIPPTPSQDIKDQPRKKQPLGALASLLALLGQTLAQIETLKLIRAFQRGRDELIDDYIR
RSSQLATEYFKLGKVSRAGNVFSQTHRTVLESKVLVDNGIKVEHLLRWSCYLAGTGDIVK
AREAYIEAQELNRGFESTKSKSHLLHVQVMNRCDTLERAAWSRAAFGAINAAEDNATGAI
IHLSAAFRLWTRASDAICRIAEKQPSPNASTLDLEDPFLVTPNPKRPKGADEPAKDESGP
TPSQAAHFSGKHLHNLQWHVAHGLLDVTFDLASAYAARGSVRDAEYFLKVAGLVSETIKS
GSMGARVGTREAELLFRLRKLEEVGTKLESAAGLLCTEEGPEVVDLMKVQGDLYTRQGMI
EEAGQMFQSTSSEIAGLDSVFVAAEALLPTGRTAQTLRKSTDSKEPLLPVALAHVMRQHA
WLLREVGSKEECTQLLAKIKNLPSTTQTKVCALSKGTNLYYKFILTSL
NT seq 4287 nt NT seq  +upstreamnt  +downstreamnt
atgccaccacgaacaacaggtcaaagggcggctctggctgcccgtaacgtaccaatgcgt
actagtgcccgctctggaactcaggttccgacggcggcggatgagctcgtggacgggatc
aacaagctcgcggtatcaaaacccgaacccaaggttcgtttgactaggacaaagccttca
tcatccaaggcagcctcttcaatttcgacgaaagctataaacgaaaggcccgcgacagca
aatgcagcgaacagaaaagagaaagcgacatttgaagacttgctgccatgggcatgttcg
acagccgcacttggtgaatctgagaactctggctatcgttatggctcattcaatgtgtct
aacgaagggagcgaatggacggatgagaaggtggttagattggtcgatacttgtcaagtg
gccttcagggtattgagagagctggatgaacaaggcatgattggggataaaggtgcagaa
gttgaacggacttgtcagggtgtggtgaccaagtgcctgaatatggggatggttcataaa
gctatggaagtgctcgtcgaggctaggcccgctttactgagactatataaggccatgaat
gttgaagcttccaaaattactgctatcaaggtgccaactacttcgagagctaccagttcc
tcaaggtccactgtcggcgttgcaagcaagaccgccactactacgtctcgctcaactcct
gccacatctcggtccactcgccccacatcagttgccgaatccgcaaaatcatctctgaag
agtggacgaaaggcttcggtgcctagcagatggttagaattagcatggttcccggcaccc
atggaaggcacagaaatgtcagagccggtgaagaatctactatttatggcgatggtatca
gcgtggacaggactcatcgctactagcaaaggctctgaagaggttctggcgatgatgccg
gcaacgcctgattcagccaagctcaaccctcttgctttgggtcttacacttcctctgact
tccatcaccccccctctatattgcctttatcgagccattgacactctgaacctcccgtca
acctcatctttaaacattcgttatcgccaaattgcactattcgctttatcaatgactata
tgttcatctgctcactcgagaaattctcccacccgtttatgggaagctgcccatcgagct
atttcaacgtatgtccaggttcaaaactccagtgaggatttgtcggaggcagcgcaagtc
attaaaaagctcgtcgactgggttgagagcatggtgggaaagcgaggggaaaatgtgaaa
gactggttaagtggtaaaggttggttaggattgatggagatatggattgcgcttggtagg
cggctcgatgatgtaaatatcatcgacaaggcattatctctcatggcctcctcgagctcg
atatctacgccgccttcaaccgcgctttcaactgaagaacctgtcagttggaccctcacg
ggatcacccgaagtagaagtagctaggataaggggtgatcttgccaaagccagtcttatg
tttgataagatcttttctggtcgatcattgccaactccagaccaacagtgcatcgatgcc
ctttcccttgaagatcttaatgtccttggacaagccgtcaacacgttaccgaacgacgaa
gaatctaatgttctcattgatcgggtcgtgcgagcctgggaaagggttagacgagggtgt
gtcaagattattgaccggtacggtacagaagagagctgtaagatgcttgtaggcctggtc
gagagatggtccagggcagcattagattttgtggaaaacgttgctggccgaattgagatt
aatccctttttagcagactatctcattacgggtataatagataccatctgctttctttct
cagcgacatctttcatcttcatccatcctgcttcctcgtggttatgaacttcaccgacgc
gtcaagggttcaacaaaagtcgttgatcaaattgactggcttagagccttatcaatagcg
gcgtctaacatcggcggaagattattttctcaatcaaggatggaggcagctgtacatctg
gccagcttaagctgtgggtgggctgttgaggttgggaatcttgtgaaagtcgaggaaatg
gatgaagaaggagacaaaaaagtacagcaacttagcgagggattggcaaagcgatgggag
ttcctggcaagctgttaccagagacacgggcagaaaaaagaggtcttttcggcttacatc
cagtgccttgcttatcaaccgccttctctcctatcaaaactcacccgtgcggcatctcaa
cccatttccaaaatctttgagccattcacagactttcaaaattcacttcttcgactctct
gctttcatcctctatgaccctacactttgtagtgattttggtatatcgctaatgaaggag
atgactacgaacagttataaacctcatgaagtaggagccattggagagaagatgatggac
accctcgaggatggggcgtggaaagaagaagtagctcgcattgtcttggacttaggagaa
ggcttgttagatgtgtatggtaccgagtttcccataaggagactcagggtcgttacaaga
atgatgcggattatcgtttcatctggtcaacgaatgcctagattcgatcgtttggttgaa
gacgctgatcatctcttcgctcaaactaatctcggtcatgacatctctcttggccagtac
aaaaaagaacactacgcatacactcttatcctgcgcgctctgagagcctatcattttgaa
ggagaccccacaccagcagtccttaagaatcacaaacaagcaatggaagctttacatgag
gtacttatccctcccaccccctctcaagatatcaaagaccaacctagaaagaaacagccg
ctgggtgcacttgcgtcgctgcttgctcttcttggccaaactcttgctcagatcgagact
ctgaagctaattcgtgccttccaaagaggtcgggacgaactcatcgacgattatattcgc
cgttcatcccagcttgccactgagtatttcaagctcggcaaggtgtctcgagctggaaac
gttttttctcagacgcataggacagtcttagagagcaaggtacttgtagacaatggtatc
aaggttgagcacctattgagatggagctgttacttggcgggtacaggggacattgtcaag
gcgcgagaggcatatatcgaggcccaagagctcaatcgtggcttcgaatctaccaagagc
aagtcgcatctgctccatgtacaggttatgaaccgctgcgatacgttagaacgagcagct
tggtcgagggcggccttcggtgctatcaacgctgcagaggacaacgctacaggtgccatc
atccacctttccgcagccttccgtctttggactcgtgcatcagacgctatttgccgtata
gctgaaaaacaaccctcgcccaatgcatccacattagacctcgaagatcctttccttgtc
acgcctaatcctaagcgacccaaaggtgcagacgagcctgccaaagacgaaagtggtccc
acgccttctcaagctgctcacttcagtggaaagcacctgcataacctacaatggcacgtt
gcgcacggtcttttggatgtgacatttgacttggcttcagcttatgccgcaagaggatca
gtaagggatgccgaatatttcttgaaagtggcaggattggtcagtgagacgatcaaaagc
ggaagcatgggtgcaagagtaggaactcgggaagccgaattgctctttaggttaagaaag
ctggaagaggtcgggactaagctggagagtgctgccggactgttgtgtactgaggaagga
cctgaagtagtcgatctcatgaaagtccagggtgacctgtatactcgacaggggatgatt
gaagaagcgggacagatgttccaaagtacatctagcgaaatcgcagggcttgattctgta
tttgtggctgccgaggctctactacctaccggccggactgcccaaactttgagaaagagt
accgatagtaaagagcctttgttgccagtggctttggcacatgtcatgagacagcatgca
tggcttttgagggaggtgggctcgaaagaggaatgtacacagctactggctaagataaaa
aacttaccctctacgacccagaccaaagtatgtgcactttcaaaaggtacaaacttatat
tacaaatttatactaacgagtctctag

DBGET integrated database retrieval system