KEGG   Cryptococcus gattii: CGB_C3390WHelp
Entry
CGB_C3390W        CDS       T02232                                 

Definition
(RefSeq) heat shock protein 70
Organism
cgi  Cryptococcus gattii
Pathway
cgi03040  Spliceosome
cgi04141  Protein processing in endoplasmic reticulum
cgi04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:cgi00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    CGB_C3390W
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    CGB_C3390W
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    CGB_C3390W
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C Hydantoinase_A eIF3_subunit
Motif
Other DBs
NCBI-GeneID: 10187290
NCBI-ProteinID: XP_003192735
UniProt: E6R387
Position
C:join(713307..713333,713387..713441,713497..713750,713804..714215,714271..715067,715122..715388,715440..715550)
Genome map
AA seq 640 aa AA seqDB search
MVKAVGIDLGTTYSCVAVWQNDRVEIIANDQGNRTTPSYVAFNDSERLIGDAAKNQVAMN
PYNTVFDAKRLIGRKFDDAEVQADMKHWPFKVISRSGKPAIQVEYRGEEKVFTPEEISSM
VLIKMKETAEAYLGGTVSKAVVTVPAYFNDSQRQATKDAGAIAGLDVLRIINEPTAAAIA
YGLDKKSEGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRLVNHFV
QEFKRKNKKDLSSNARALRRLRTACERAKRTLSSAAQTSIEIDSLFDGIDFYTSITRARF
EELCQDLFRSTMDPVEKVLRDSKIDKSSVNEIVLVGGSTRIPKIQKLVSDMFSGREPNRS
INPDEAVAYGAAVQAAILTGDTSEATQDLLLLDVAPLSMGIETAGGIMTPLIKRNTTVPT
KKSEIFSTYSDNQPGVLIQVFEGERAKTKDCNLLGKFDLSGIPPAPRGVPQIEVSFDVDA
NGILNVNAADKSTGKSNKITITNDKGRLSKEEIERMLAEAEKFKAEDEAAAATVQAKNGL
ESYAYSLKTTLSDNQDKFDSADHETLTKKVDEVISSLDTMQSASKEEFESLQKELESVAN
PIMTKFYGAQGGAPGGAPGGFPGAGGAPAHEDGPSVEEVD
NT seq 1923 nt NT seq  +upstreamnt  +downstreamnt
atggtcaaggctgttggtattgatttgggtactacctactcttgtgttgccgtctggcaa
aatgaccgtgttgagattatcgcgaacgaccagggtaaccgaactactccctcttacgtc
gctttcaacgactctgagcgattgatcggtgacgccgccaagaaccaggtcgccatgaac
ccttacaacactgttttcgacgccaagcgattgattggacgaaagttcgatgatgctgag
gttcaggccgacatgaagcactggcccttcaaggtcatcagccgttccggcaaacccgcc
atccaggtcgagtacaggggtgaggagaaggttttcactcccgaagaaatctcttccatg
gtccttatcaagatgaaggagactgctgaggcttacctcggtggcaccgtctccaaggcc
gttgttaccgtccccgcctactttaacgactctcagcgtcaggctaccaaggacgccggt
gccattgccggtcttgatgtcctccgtatcatcaacgagcctactgccgccgctatcgct
tacggtcttgacaagaagtctgagggtgagaagaacgttttgatcttcgaccttggtggt
ggtactttcgatgtgtctctcttgaccattgaggagggtatcttcgaggttaaggctacc
gctggtgacacccatcttggtggtgaggacttcgacaaccgacttgtcaaccacttcgtc
caggagttcaagaggaagaacaagaaggacctttcttctaacgcccgagctctccgacga
ctccgaaccgcctgtgagcgtgctaagcgaactctttcttccgctgcccagacttctatt
gagatcgactctctcttcgatggtatcgacttctacacctccatcacccgagcccgattc
gaggagctctgtcaggacctcttccgatccaccatggaccccgtcgagaaggttctccga
gactccaagattgacaagtcctccgttaacgagattgtcctcgttggtggttccacccgt
atccccaagatccagaagctcgtctccgacatgttctctggccgagagcccaacaggtcc
atcaaccccgacgaggccgtcgcctatggtgccgccgtccaggcagctatccttactggt
gacacttctgaggccactcaggacttgctcttgctcgatgttgcccctctctccatgggt
atcgagactgctggtggtatcatgactcctttgatcaagaggaacaccactgtccccact
aagaagtctgagatcttctctacctactctgacaaccagcccggtgtcttaatccaggtc
tttgagggtgaacgagccaagactaaggactgcaacttgctcggcaagttcgacctttct
ggtatcccccctgctcctcgaggtgttcctcagatcgaggtttccttcgatgttgacgcc
aacggtatcttgaacgtcaacgccgccgacaagtctaccggtaagagcaacaagatcacc
atcaccaacgacaagggccgattgtccaaggaggagatcgagaggatgcttgccgaggct
gagaagttcaaggctgaggatgaggctgctgccgccactgtccaggccaagaacggtctt
gagtcttacgcttactctctcaagaccactctttccgacaaccaggacaagttcgactct
gccgaccacgagactcttaccaagaaggtcgacgaggttatctcttccctcgacaccatg
cagtccgcttccaaggaagagtttgagagcttgcagaaggagctcgagagtgttgccaac
cccatcatgactaagttctacggtgctcaaggcggcgctcccggcggtgcccctggtggc
ttccccggtgctggcggtgctcccgctcacgaggatggcccttccgttgaggaggttgac
taa

DBGET integrated database retrieval system