KEGG   Cryptococcus gattii: CGB_C5090CHelp
Entry
CGB_C5090C        CDS       T02232                                 

Definition
(RefSeq) transcriptional elongation regulator
  KO
K09578  peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 [EC:5.2.1.8]
Organism
cgi  Cryptococcus gattii
Brite
KEGG Orthology (KO) [BR:cgi00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:cgi03021]
    CGB_C5090C
   03110 Chaperones and folding catalysts [BR:cgi03110]
    CGB_C5090C
Enzymes [BR:cgi01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     CGB_C5090C
Transcription machinery [BR:cgi03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     CGB_C5090C
Chaperones and folding catalysts [BR:cgi03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Parvulin
    CGB_C5090C
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Rotamase_3 Rotamase WW Rotamase_2 WW_1 DUF1993
Motif
Other DBs
NCBI-GeneID: 10187630
NCBI-ProteinID: XP_003192910
UniProt: E6R3I7
Position
C:complement(join(1001888..1001974,1002039..1002233,1002284..1002538))
Genome map
AA seq 178 aa AA seqDB search
MSSNGWEIRFSNSRQIPYFYNSERSISTWEPPSELSAEQIQQLPGAAKYMNLQSAQTSGG
KEGQVRASHILAKHAGSRRPASWRNDKITIPPDEAQAIIEKHIAYLQSLPPADVPKEFAR
IASTESDCSSAKKGGDLGWFGRGQMQKPFEDATFNTPVGQLSGIVKTDSGIHVILRTG
NT seq 537 nt NT seq  +upstreamnt  +downstreamnt
atgtcatcaaacggctgggaaattcgcttctccaattctcgtcagatcccctacttctac
aactcggaacgtagcatctccacttgggaacccccttctgaactcagtgcagaacaaatc
cagcaattacccggtgcggccaagtatatgaatctacagtcggctcaaacttctggtggc
aaggaaggtcaggtgagagctagtcatattctggcaaagcatgctggaagtaggaggcct
gcttcatggagaaatgacaaaatcacaatccctcctgatgaggctcaagctatcattgag
aagcacatagcatatcttcaatccctccctcctgctgatgttcccaaggaattcgcaagg
attgcctcaacagagagcgattgctcaagcgcgaagaaaggtggtgatcttggatggttt
gggaggggacaaatgcaaaagccctttgaagacgccacgtttaacactcctgttgggcag
ctaagcgggattgtcaagacggactctggtatccatgtcatcctccgtactggatag

DBGET integrated database retrieval system