KEGG   Cryptococcus gattii: CGB_C6780WHelp
Entry
CGB_C6780W        CDS       T02232                                 

Definition
(RefSeq) threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
cgi  Cryptococcus gattii
Pathway
cgi00260  Glycine, serine and threonine metabolism
cgi01100  Metabolic pathways
cgi01110  Biosynthesis of secondary metabolites
cgi01130  Biosynthesis of antibiotics
cgi01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cgi00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CGB_C6780W
Enzymes [BR:cgi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     CGB_C6780W
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 Cys_Met_Meta_PP Aminotran_5
Motif
Other DBs
NCBI-GeneID: 10190916
NCBI-ProteinID: XP_003193223
UniProt: E6R1V4
Position
C:join(1370186..1370390,1370464..1370634,1370708..1370788,1370839..1371157,1371216..1371510,1371566..1371874)
Genome map
AA seq 459 aa AA seqDB search
MVRIAYFKYACLMPTRISVPAIFPKRLTVTTTPIAMPIASSKPSAEVTLDVGGQANVDQL
HRVSRDFRSDTITIPTDAQLLYSLKATRGDDVYGEDPSTAALEKRIAKLTGKEAAMFAVS
GTMTNQLAIRTHMKQPPHSVITDWRAHVHKMEAGGIAMFSQATTHQIVPENGLHLTVEDI
EPALQLGTNIHIAPTKLICLENTLSGMVFPQEEIVKIGEMARKHDIGMHLDGARIWNVAA
DVIAKRGLNPNKEEDLQTVLTELIAPFDSASLCLSKGLGAPIGSALVGTKEFIDRAKWFR
KAFGGGIRQAGGIAASADYAITHHFPRLVKTHELASRLEHGLRELGCDILAPVDTNMVFF
QPKPIGLPLDAVMARLAALPDPIIIGRERCVVHHQICPQAIEDFIGCIAEMKKEKEENGE
CKVTTLGQEEKDKLYRFVGSETNDETSEAELRKKAALGY
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atggtccgcatcgcgtactttaaatacgcctgcttgatgccaacaaggatttccgtacca
gctatctttccaaaaagattaaccgtgacgaccacacctatcgctatgcccatagcttct
tccaagccctccgcagaggtaacccttgatgttggtggacaagcaaacgtcgatcaatta
cacagggtatctcgtgactttcgtagtgataccattactattcctacagacgctcagctc
ctttactctctaaaggccacgagaggtgatgatgtatacggtgaagatccttcaacggcg
gcgcttgaaaaacgcatagcgaaactcaccggtaaggaggctgccatgtttgcagtcagt
ggcaccatgaccaatcagctggccatcagaacacacatgaaacaaccaccgcacagtgta
atcactgactggcgagcacatgtccataagatggaagctggtgggatcgcaatgttttct
caggcaactacccatcaaattgtaccggaaaatggtttacacttgaccgtggaggatatc
gagccggctttgcagctgggcaccaatattcacattgctcctacgaagcttatttgcctc
gagaatactttgtctggcatggttttcccgcaagaggagatcgtgaagattggggaaatg
gcaaggaaacatgacatcggcatgcatcttgatggcgcgaggatctggaacgttgctgcc
gatgttatcgcgaagagaggactgaatcccaataaagaggaggatctccagactgttctt
accgaacttattgctccctttgactcggcatcgctctgcctctctaagggcctaggtgca
cctattggttcggcattggtcggtactaaagaattcatcgaccgcgccaagtggttccgc
aaggcttttgggggaggtatcaggcaggctggcgggatagctgcgtctgcggattacgct
ataacgcatcacttcccaagacttgtaaagacacacgaacttgcatcgcgactggagcat
gggttgagagagctggggtgtgatatcctagcgccagtggacaccaacatggtatttttc
caacctaaaccaattggactccctctcgacgctgtcatggccaggctggctgctcttcct
gaccccatcattatcggtcgtgaacgttgcgttgtccatcatcagatttgcccgcaagcg
attgaagattttattggctgtatcgccgaaatgaagaaagaaaaagaagaaaacggcgag
tgcaaggttaccacgctagggcaggaggagaaagacaaattgtataggtttgtaggttcg
gaaaccaatgacgaaacgagcgaagccgaattgagaaagaaggctgctttgggatattaa

DBGET integrated database retrieval system