KEGG   Cryptococcus gattii: CGB_C8210CHelp
Entry
CGB_C8210C        CDS       T02232                                 

Definition
(RefSeq) hypothetical protein
  KO
K17498  transcription factor SPN1
Organism
cgi  Cryptococcus gattii
Brite
KEGG Orthology (KO) [BR:cgi00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:cgi03021]
    CGB_C8210C
Transcription machinery [BR:cgi03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Others
     CGB_C8210C
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Med26
Motif
Other DBs
NCBI-GeneID: 10188011
NCBI-ProteinID: XP_003193126
UniProt: E6R251
Position
C:complement(join(1630260..1630394,1630455..1630793,1630851..1630980,1631039..1631187,1631236..1631327,1631384..1631966))
Genome map
AA seq 475 aa AA seqDB search
MSSSTLDTVPGQTEEQDLPNEVQAQEPSPVEPTPEVPVEAESDGQDDEEQPGAQVSEQEQ
EHAAEKERLQDQEDQEQGAELVPQQATAEEQEETRDELYNEVFGNQGSDASDLSDDEDAR
MDEGDKYVPATLTSAAKIPKFKKSKRDDEDEDEDEDDEDGREERRRKKKKKAERRRQREE
EEEEEEAPVLDEATQRRLALEERIDAIGKKPKAVRRKKKGDDDVDIVDSYHDDICARLRD
RMIAAADKDEAANKIKMPGTAKLAMLDEVMAVLRNTTLWQSIVDNGVLEAVKRWLEPLPD
KSLPSVGIQKAIFEVLPKMDLDTTTLKECRLGPIVLFYTKTKRVTPAINRQADALVQAWS
RPIIKRPANYRSRYIESQNEVEQSQGGGSGTGGGYSQSQRGTGERRFKRFDVKKALEENA
HRKGARLQIVQDVQYTVAPEPKTQHQAEEMQHVSRIQQDNKKFNRFARQVKTKKH
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgtcctcttccacccttgacacagtccctggccaaacagaagagcaggatcttcccaac
gaggtgcaagcacaagagccctcaccggttgaacctacgccagaagtgccagtagaggcc
gagtctgacggccaggacgacgaggagcagcccggggctcaggtgtcagaacaagaacaa
gaacatgccgcagagaaagagcgactgcaagaccaggaagaccaagagcaaggcgcagag
ctggtgccgcagcaggccaccgccgaggagcaggaggaaactcgagatgaactttacaat
gaagtcttcggtaatcaaggctctgatgcttcggatttgtcagatgacgaagatgcgaga
atggacgaaggagataagtatgtgcctgctactttgacgagtgcagccaaaattcctaag
ttcaaaaaatctaagagggacgatgaggatgaagatgaggatgaggacgatgaggatggt
agggaggagaggagaaggaagaagaagaagaaggcagagaggagaaggcagagagaagag
gaagaagaggaagaggaggcacctgtgcttgatgaggctactcagcgacgtcttgctttg
gaggagagaatagatgctattggcaagaagcccaaggccgtcagacggaagaagaagggt
gacgacgatgttgatattgtggattcttaccatgacgacatttgcgctcgtcttcgagac
cgaatgatcgctgcggcggacaaggatgaggctgctaacaagatcaaaatgcccggtaca
gcgaagctggccatgttggatgaagtgatggctgtgttgagaaacacgaccctttggcag
tcgatcgttgataacggcgtgcttgaagctgtcaagagatggcttgagcctttgccagac
aagagcttgccgagtgttggtattcaaaaggctatttttgaagttcttccgaagatggac
ctcgatacaaccaccttgaaagaatgccgtctcggtcccatcgtcctcttctacaccaag
actaagcgcgttacacccgctatcaaccgacaagccgacgcacttgtccaggcttggtcc
cgaccgatcatcaagcgacctgcaaactaccgatcgcgatacattgagagtcagaacgag
gttgaacagtcacaaggtggtggcagtggtactggaggcggttacagtcagagccaacga
ggtacaggagagaggaggttcaagaggttcgatgtcaaaaaagctttggaagagaatgcg
cacaggaagggtgctagattgcagattgtccaggatgtgcaatacactgtcgcgcccgaa
cccaagacgcagcatcaagccgaagagatgcaacacgtctcccgaattcaacaagataat
aaaaagttcaacaggtttgcaaggcaagtcaaaactaagaagcattag

DBGET integrated database retrieval system