KEGG   Cryptococcus gattii: CGB_D2240CHelp
Entry
CGB_D2240C        CDS       T02232                                 

Definition
(RefSeq) exo-beta-1,3-glucanase
  KO
K01210  glucan 1,3-beta-glucosidase [EC:3.2.1.58]
Organism
cgi  Cryptococcus gattii
Pathway
cgi00500  Starch and sucrose metabolism
cgi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cgi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CGB_D2240C
Enzymes [BR:cgi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.58  glucan 1,3-beta-glucosidase
     CGB_D2240C
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cellulase RskA
Motif
Other DBs
NCBI-GeneID: 10191103
NCBI-ProteinID: XP_003193455
UniProt: E6R5R1
Position
D:complement(join(516017..516382,516436..516527,516577..516685,516740..517413,517464..517659,517710..517852,517904..518006,518060..518312,518361..518638,518749..519027))
Genome map
AA seq 830 aa AA seqDB search
MRRSSYGPVANQDLSPDLNVSPNLDRNSSFLDPEANNLLGRPTSEYAPAPSLMSRDSTAA
SMNLLGGTPSLAGTHRDSWGSGLELTGAEGTNGGNRNPGRSGLAHSAVPYASGERLSTSD
EDDEQGHITPAVAAIGTGAAARGTSEKPKWAEYEPSKGKKNRRWLWAALAALLIIAIGLG
VGLGVGLTRNKDNKVLAASAGGEHSSSSAPSKTSSGSGSTGTASSSSATASATPTTGTQG
SLITLEDGSTMTYDNPYGGKWVWDEANPFNNEAQANSWTPALNQNWTWGQDKVFGVNLGG
WLVIEPFIVPGLYEKYANGSAGTAIDEYTLSINMGDNLTAALTEHYETFITERDFVEIVA
AGLNWVRIPIPFFAIEVWEGEPYLPKVQWQYVLKAIKWARKYGIRVNLDLHSVPGSQNGW
NHSGRQGSVNWMNGAMGLANAQRSLDYIRTLAQFIAQPEYAPVIQMFGFLNEPNGNAISK
SPIGSFYIQAHNIIREITGIGAGKGPMLSMHDGFLGVTQWYGDLAGADRMMLDQHTYMVF
QDQPQGDLDALKVMPCQWWASSTNTTSQQWGPNTAGEWSAAWNDCGLWVNNVGSGSRYDG
SYDGYATKVTGSCTYWNDYTQWNQSTIDALNHFVSGSMDALQNFFFWTWKIGNSTGAIQE
VNPFWHYRLGLAKGWIPKDPRTAAGTCQGDGVALNNFDGTYSNAYVTGGSGAGTIAASAS
SSYPWPPASFTNVAANSMSLLAQYTQTGTPITMPGPTFTSPGSTATLNAGNGWFNADAGD
KQAYAAVSGCTYPPEYSAADLAISTGACGAGLTQANKRFAEPTPAPSPTR
NT seq 2493 nt NT seq  +upstreamnt  +downstreamnt
atgcggcgctcatcttatggcccagtggcgaaccaagacctctccccagacctcaatgtc
tcccctaacctcgaccgtaattccagctttctcgacccagaagcaaataaccttcttgga
aggcccacgtccgaatatgctccggcaccgtcgctcatgagccgtgattctacagcagca
agcatgaatcttctggggggaacaccatctctggctggcacacatagggatagttggggc
agtggattagaactgactggtgctgaaggaaccaacggtggtaatcgtaacccaggtcga
tctggccttgcccattcagctgttccttatgcaagcggcgaacgattatccactagcgat
gaggatgacgagcagggccatatcactcccgccgtcgcggccattgggacaggagcagca
gcacgagggaccagtgaaaagccaaaatgggcagagtacgagcctagcaagggaaagaag
aacaggagatggctgtgggcagctttggcagctttgctgattattgccatcggcctcggt
gttggccttggtgtcggcctcactcgaaacaaggacaacaaagtcttggccgcttctgct
ggtggcgaacattcttcatcatccgctccatcgaaaacatcttcgggatcaggatcaacg
ggaactgcatcgagtagcagcgcgactgcgtctgctaccccaaccaccggcactcaaggt
tccctcatcaccttggaagacggttccacgatgacttatgacaacccctacggtggcaag
tgggtatgggacgaggccaacccgtttaacaatgaagcccaggccaactcttggacacca
gcgctcaatcaaaactggacatggggtcaagataaagtctttggtgttaatctcggtggt
tggcttgttattgagcccttcatcgttcccggcctttacgaaaagtatgccaacggctct
gctggcactgctatcgatgaatacactctttctatcaatatgggtgacaaccttactgct
gcacttaccgaacactacgagacattcattaccgagcgtgactttgttgaaatcgtcgct
gctggtctcaactgggtgcgaatccctattcccttctttgctattgaggtctgggagggt
gagccttatctgcccaaggttcaatggcagtacgttttgaaagctatcaaatgggccagg
aagtatggaataagggttaaccttgaccttcactctgttcccggttctcaaaacggctgg
aaccactctggtcgccaggggtctgtcaactggatgaacggtgccatgggtcttgccaac
gctcaacgatctctcgactacatccgtacccttgctcagttcattgctcagcccgagtac
gctcctgttatccagatgtttggattccttaatgagcccaacggcaatgctatcagcaaa
agcccaatcggctccttttacattcaggctcacaacatcattcgtgaaattactggtatc
ggtgccggcaagggtcctatgctatcgatgcacgatggatttttgggagttactcagtgg
tacggcgatcttgctggcgctgaccgtatgatgctcgaccaacatacctacatggtcttc
caggaccagcctcagggcgatcttgacgctcttaaagtgatgccttgccagtggtgggcg
tcatccaccaacaccacctcccagcaatggggtcccaataccgccggtgaatggtctgct
gcctggaatgattgtggcctctgggtgaacaatgtcggaagtggatcgagatacgatgga
tcttatgacggttatgcgaccaaggtgaccggcagctgtacctattggaacgactatacg
cagtggaaccaaagtaccatcgatgcgttgaaccactttgtctctggtagtatggatgct
ttgcagaactttttcttttggacttggaagattggaaacagtaccggtgctattcaggag
gtcaacccattctggcactaccgtcttggtcttgcgaagggatggatccccaaagaccct
cgaacggctgctggtacctgtcagggagacggtgtggcgctgaacaactttgacggaacg
tactccaatgcctacgtgactggtggttccggtgccggtaccattgccgcatccgcatca
tcttcctacccctggcctcctgcgtcattcaccaatgtcgccgccaactccatgtctctt
cttgctcaatatactcagaccggtactcctattaccatgcctggacctacctttacctct
cccgggtctactgccaccttgaatgcgggtaacggatggttcaacgcggacgctggtgat
aagcaggcgtacgccgctgtcagcgggtgtacctatcctccagagtattctgcggctgat
ttggctatttcaacgggtgcttgcggtgcggggttgacccaggcgaacaagaggttcgct
gagcctactcctgccccttctcctacaagatga

DBGET integrated database retrieval system