KEGG   Cryptococcus gattii: CGB_D7240WHelp
Entry
CGB_D7240W        CDS       T02232                                 

Definition
(RefSeq) methionyl-tRNA synthetase; Mes1p
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
cgi  Cryptococcus gattii
Pathway
cgi00450  Selenocompound metabolism
cgi00970  Aminoacyl-tRNA biosynthesis
cgi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cgi00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    CGB_D7240W
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    CGB_D7240W
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cgi01007]
    CGB_D7240W
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:cgi03016]
    CGB_D7240W
Enzymes [BR:cgi01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     CGB_D7240W
Amino acid related enzymes [BR:cgi01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   CGB_D7240W
Transfer RNA biogenesis [BR:cgi03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    CGB_D7240W
 Prokaryotic type
   Other AARSs
    CGB_D7240W
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 Anticodon_1
Motif
Other DBs
NCBI-GeneID: 10189598
NCBI-ProteinID: XP_003193784
UniProt: E6R4J8
Position
D:join(1626241..1626311,1626369..1626418,1626488..1626524,1626578..1626641,1626695..1626736,1626785..1626855,1626907..1627105,1627161..1627518,1627565..1627684,1627732..1628033,1628085..1628945)
Genome map
AA seq 724 aa AA seqDB search
MSVRNIREYEGLLMNIHDPSKGPVLPKDGQRNVLITSALPYVNNVPHLGNIIGSTLSADV
FARYNRTLNVPTLYICGTDEYGTATETKALEEGVTPYELCTKFHKLHTEIYEWFQISFDK
WGRTSTPEHTEITQGIYKRLHDNGLFRLETSDQTYCEDDELFLADRFVEGTCPNCGYDDA
RGDQCDKCALTFSSPTQLINPRCKRNKAHTLSVRPSTHACYRLDLLQPRLVEWMQDARVK
GKWGTNAVITDKGEIVEPRMLGEGLRPSAVTRDLKWGVEVPKVGDEEEDKAMEGKVIYVW
FDAPIGYPSITATYTDKWEKWWKNPDNVELYQFMGKDNVYFHTVLFPATLLGTKEPWTML
HTISSTQYLNYEDTKFSKSRNIGVFGNNARETGQPPEVWRYYLLSQRPENSDSSFLWSKF
IAANNNELLANLGNFVNRVVKFINAKLDSKVPGPEGFAGGEVVPPSDSSDFDFVTDVNTR
LKEYREQMDDTKLRGGLATAMALSARGNQYLQENSLDNALLASKPERCAEVLLNAVNLIY
ILSVVFHPFMPNTSEGILRQLNAPARSLPTKFSIDILPGHVLGKAEYLFKKIDNVNGEQE
KKWQRQYGGDAVVADQVVPPGPGGHPEGGKVPKAKDISAESKKAAHEARKAQLAKEKKAA
QAAADAKKTPEEKELEAKVEAQGKKLAAIKKGLEEGDAEEEMSVAKSLKTELAELRKRLK
GITI
NT seq 2175 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtccggaatattagagaatatgagggacttctcatgaacattcatgacccctct
aagggcccagtcctcccaaaggacggacaaaggaatgtccttatcacttctgctttacct
tatgtgaacaacgtaccacaccttggcaacatcatcggctctactctctccgcggacgtt
ttcgcaagatacaatcggacactcaacgtgcccaccctctacatttgcggaaccgatgag
tatggaaccgctaccgagacgaaggccttagaagagggtgtcaccccatacgaactttgt
accaaattccacaaattacatacggagatttacgaatggttccagatcagcttcgacaaa
tgggggcgtacttcgactccagaacatactgagattacccagggaatttacaagcgcctc
catgataacgggcttttccgtctggaaaccagcgaccagacttattgcgaagatgacgaa
ctttttttggctgatcgctttgtggaaggcacttgtcctaattgcggctatgacgatgcc
cgaggtgaccagtgtgacaagtgcgcactcaccttttcatcccctactcaacttatcaac
cctcgctgcaaacgcaacaaggcacacaccctttctgttcggccttctacgcatgcctgc
tatcgtttggacctgctccaacctcggctggttgagtggatgcaagacgctcgtgtcaag
ggaaagtggggaacgaatgcggtcatcactgataaaggggagatcgtggagccgaggatg
ctaggagaaggtttgaggcctagtgccgtaacgagagatttgaaatggggtgttgaagtt
ccgaaagtcggagacgaagaggaggataaggccatggagggcaaagtaatctatgtctgg
ttcgatgctcctattggctatccttcgatcacagcaacctacaccgacaaatgggagaaa
tggtggaaaaaccctgacaatgtggagctctatcaattcatgggcaaagacaacgtttat
ttccataccgttctatttccagctacgctgctcggtaccaaagaaccctggaccatgctt
cataccatctctagcactcagtatttgaactatgaagatacaaagttcagcaagagtagg
aatattggtgtgtttggcaacaatgcacgagagacaggacagccccctgaggtttggagg
tattatctcctctcccagcgaccggagaacagcgactcgtccttcttgtggtccaaattc
attgccgctaacaacaatgagctcttggccaacctgggcaactttgtcaaccgagttgtc
aaattcatcaacgcgaaactcgattctaaggtgcctggcccggaaggttttgccggtggc
gaagttgtccccccttctgattcttcagatttcgattttgtgaccgatgtcaacacccgc
ctcaaagaatatcgcgaacaaatggatgacactaaacttcgcggtggtcttgcaactgca
atggctctttctgctcgtggtaaccaatacctacaagaaaattctttggacaatgccctt
cttgcgagcaaacctgagcgatgtgccgaggttttgctcaatgccgtcaacctcatttat
atcttgagcgtggtgttccacccctttatgccaaacacttctgaaggtatattgcggcaa
ctcaacgctcctgcccgatctctccctaccaaattctctatcgacattcttccgggtcat
gttttgggcaaagccgaatatttgttcaagaagattgataacgtcaatggagagcaggag
aaaaagtggcaaaggcaatatggaggggatgcggtggtggcagatcaggttgtgccaccg
ggccccggcggtcaccccgaggggggcaaagttccaaaagccaaggatatcagcgcagaa
tccaaaaaggctgcgcacgaggctcgcaaagcccaacttgctaaagaaaagaaggctgct
caggctgctgctgatgcgaagaagactcctgaagagaaggagttggaggcaaaggtggag
gctcaaggcaagaagctagcagcgattaagaaggggctagaagaaggtgatgccgaggaa
gagatgagcgtcgcgaagagtttgaaaactgagttggctgaattacgaaagagactgaaa
ggaattaccatttag

DBGET integrated database retrieval system