KEGG   Cryptococcus gattii: CGB_D9190CHelp
Entry
CGB_D9190C        CDS       T02232                                 

Definition
(RefSeq) glycogen (starch) synthase
  KO
K00693  glycogen synthase [EC:2.4.1.11]
Organism
cgi  Cryptococcus gattii
Pathway
cgi00500  Starch and sucrose metabolism
cgi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cgi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CGB_D9190C
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:cgi01003]
    CGB_D9190C
Enzymes [BR:cgi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     CGB_D9190C
Glycosyltransferases [BR:cgi01003]
 Polysaccharide
  Storage polysaccharide
   CGB_D9190C
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycogen_syn Glycos_transf_1 Glyco_trans_1_4 Glyco_transf_5 Glyco_transf_4 Glyco_trans_4_4
Motif
Other DBs
NCBI-GeneID: 10189920
NCBI-ProteinID: XP_003194005
UniProt: E6R509
Position
D:complement(join(2062971..2063188,2063250..2063637,2063704..2063816,2063870..2064370,2064420..2064638,2064700..2065027,2065078..2065195,2065248..2065376,2065430..2065492,2065548..2065672))
Genome map
AA seq 733 aa AA seqDB search
MPRSVHSPLLFEAAWEVANKVGGIYTVIKTKVPVTVREYGDRLCLIGPLSYKSAPVEVEA
EEPGPGPFGDALRSMQERGVKLLYGRWLIEGAPRVLLFDTGSCYNRLDEWKGDLWNLAGI
PSPPNDHETNETIVFGYMVAWFLGEFTARETDNAIIAHFHEWQAGLAIPLCRKRHIDVTT
IFTTHATLLGRYLCAGSVDFYNNLQYFDVDHEAGKRGIYHRYCIERSAAHCADVFTTVSH
ITAFESEHLLKRKPDGVLPNGLNVVKFAAMHEFQNLHVQSKEKINEFIRGHFYGHYDFDL
DNTIYMFTAGRYEFRNKGVDMFIESLARLNDRLKKMGSKTTIVAFIIMPAATNSYTIEAL
KGQAVTSQLKDCVDQVTSRIGKRIFEHACRYSGEHGTEVPNPEDLLSNEDKVLLKRRVFA
LKRNSLPPIVTHNMADDSNDPILNQLRRVQLFNRPEDRVKVIFHPEFLNSNNPILGLDYE
EFVRGCHLGVFPSYYEPFGYTPAECTVMGIPNITTNLSGFGCFMEDLLESPEDYGCYIVD
RRGQGVEESVNQLTGQLLSFSTKSRRQRINQRNRTERLSELLDWKSLGLEYVKARQLALR
RAYPDSFNDDEPDFTGVRKVGVPLSAPASPRMRTGMMTPGDYATLTEEMEHLSTQDYMGA
KSWKGINDDDDENHYPFPLVMKPRNRSDSLASAISGTATPSGGRKISEQDLAQADAALCN
VEGIHADGVNGHH
NT seq 2202 nt NT seq  +upstreamnt  +downstreamnt
atgcctcgttccgtccacagcccgctcctctttgaggctgcttgggaagtagccaacaag
gtcggaggtatttacaccgtcatcaaaactaaggtacccgttactgttagagaatatggt
gaccgtttatgtttgattggccctttgtcttacaagtctgctcctgtagaagttgaagcc
gaggagcctggacctggaccgttcggagacgctcttaggtctatgcaggagcgcggcgtg
aagcttctttacggtcgatggcttattgaaggcgcacctagggtgttgctctttgatacg
ggatcttgttacaaccgtttggacgaatggaagggtgacctctggaaccttgccggtatc
ccctcgcctcctaatgatcacgagaccaacgaaactatcgtctttggctacatggtcgcc
tggttcttgggcgagttcactgcccgcgagaccgacaacgccatcattgcccacttccat
gaatggcaagccggtttggccatccctctttgtaggaagcgacacattgacgtcaccact
atcttcaccactcacgcgactcttctgggccgttacctctgtgctggcagtgttgacttt
tacaacaacttgcagtactttgatgttgatcacgaagctggcaagaggggtatctaccac
cgatactgtatcgaaaggtctgctgcacactgtgccgatgtgttcaccaccgtcagtcac
attaccgcgtttgagagtgaacacctgttgaaaaggaagcctgatggtgtcctccccaac
ggtctcaacgttgtcaagtttgccgccatgcacgagttccagaacttgcacgttcaatcc
aaggagaagatcaatgaattcatccgtggtcatttctacggtcactatgactttgacttg
gacaacaccatttacatgttcactgctggtcgttacgagttcaggaacaagggtgtagac
atgttcattgagagtttagctcgattgaacgaccgtttgaagaagatgggctccaagact
accattgtggcattcatcatcatgcccgccgctaccaactcttacacgatcgaagctctc
aaaggtcaagccgtcacttcccagctcaaagactgcgtcgaccaagtgaccagtcgtatc
ggcaaacgaatctttgaacatgcctgtcgatactctggcgaacacggtactgaggttcct
aaccctgaagatttgctttccaacgaggacaaggttctgctcaagcgaagagtgttcgct
ctaaagcgaaactctttgccgcctatcgtcacacacaacatggcggatgattcgaacgac
cctattttaaaccaactcaggagggtacaattgttcaatagacctgaagacagggtcaag
gttatcttccaccccgagttcttaaacagtaacaatcctatcttgggtttggactatgaa
gaatttgttagaggctgtcacttgggtgtcttccctagttattacgaacccttcggttac
acccccgccgagtgtactgtcatgggtattcccaacatcaccaccaacttatccggtttc
ggttgcttcatggaggaccttcttgagtctcccgaggattatggttgttacattgtcgac
cgacgaggtcaaggtgtcgaagaatctgtcaaccagctcaccggccaactactctctttc
agcaccaaatccagaagacagcgtattaaccaacgtaaccgtactgaacgcctgagcgag
ttgcttgattggaagtccctcggtctcgagtacgtcaaggctcgtcaattggctttgagg
cgagcctaccccgactcgtttaatgacgatgagcccgactttactggtgtgcgaaaggtc
ggcgtgccgctctctgcgcctgctagcccgaggatgaggaccggaatgatgactcctggg
gattatgccacgttgactgaggagatggaacatctttctactcaagactacatgggtgct
aagagctggaaaggcatcaacgacgatgatgatgagaaccattatcctttccctctcgtc
atgaagccccgtaaccgctccgactctcttgcttctgccatctctggtaccgccacccct
tctggcggtaggaagatctccgaacaggatttggcccaggccgatgctgctttgtgtaat
gttgaagggatccacgctgatggagtaaacggacatcattaa

DBGET integrated database retrieval system