KEGG   Cryptococcus gattii: CGB_E4160WHelp
Entry
CGB_E4160W        CDS       T02232                                 

Definition
(RefSeq) cellulase
  KO
K01210  glucan 1,3-beta-glucosidase [EC:3.2.1.58]
Organism
cgi  Cryptococcus gattii
Pathway
cgi00500  Starch and sucrose metabolism
cgi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cgi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CGB_E4160W
Enzymes [BR:cgi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.58  glucan 1,3-beta-glucosidase
     CGB_E4160W
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cellulase
Motif
Other DBs
NCBI-GeneID: 10190707
NCBI-ProteinID: XP_003194332
UniProt: E6R762
Position
E:join(796937..797083,797142..797313,797366..797527,797581..797629,797688..797800,797844..798103,798150..798346,798424..798619)
Genome map
AA seq 431 aa AA seqDB search
MRLLSPFFIVPLAVVSALPALQTVDDQKRSVNVGWPYGTNKIRGVNIGGWLVTEPFITPS
LFEATGNNDIVDEWTFCQYQDYNTAQAALKNHWDTWFTEDDFARIAAAGLNHVRIPIGFW
AYDVQGGEPYIQGQADYLDRAIGWARNHNLAVIIDLHGAPGSQNGYDNSGRRGNADWATD
NTNVERTKNVIAQLSQKYSDPQYYGVVTALALLNEPATYLNDQLLQTARQYWYDAYGAAR
YPFGNSDKSGLALVIHDGFQPLSTFDSYMVEPEFEDVLLDTHNYQVFNDEYVAWNWDQHI
SSVCNLASTYSSSPLWLVVGEWSLASTDCAKYLNGRGINARYDGSYPGSSYIGSCEDKSN
DVSKFSNEYKDFMHKFWNVQTQLYEQNGQGWIHWTWKTESAADWSYEAGLDGGWIPWDAG
SHDVSLSSLCG
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgcgtttgctcagcccatttttcatagtgcccttggcggtcgtcagtgccctccctgcc
ttacagactgtggatgatcaaaaacgatccgttaatgtcggctggccttatggaactaac
aagattaggggcgtcaacattggcggatggctggtgactgaacctttcatcactccctcg
ctgtttgaagctacaggaaacaatgatatcgtcgatgaatggactttttgtcagtatcag
gattataacactgctcaagctgcgttgaagaatcattgggatacctggttcacagaggat
gattttgcccgaattgccgctgctggtctgaaccatgttcgcattcctatcggattttgg
gcatatgatgtccaaggtggtgagccatacattcaaggacaagccgactatctggataga
gctattggatgggccaggaatcacaatctcgctgtcataatagatctccacggagcccct
gggtcgcaaaatggttatgataattctggaaggaggggtaatgccgactgggccaccgat
aataccaatgtcgagagaacgaagaatgtgatcgctcagctcagccagaaatactctgac
ccccaatactacggggttgttaccgctctcgcacttttgaacgaaccggccacttatctt
aacgaccagcttcttcagactgcccgccagtactggtatgatgcctacggagcggccaga
tatccttttgggaatagcgacaagtccggcctagctcttgtcattcacgacggcttccaa
cccctcagcacctttgatagctatatggtagaaccggaatttgaagatgtcctgctcgat
acgcataactatcaggtttttaatgacgagtatgtcgcttggaactgggatcagcatatc
tcgagcgtctgtaatctggctagtacttacagcagctctcctctatggctcgttgtgggc
gagtggtctttagcctcgactgattgcgctaaatatctaaacggccgaggtatcaatgcc
cgttatgacggctcgtacccaggttcatcgtacatcggatcttgtgaagacaagtcaaat
gatgtcagcaaattttcgaacgagtacaaagacttcatgcacaagttttggaacgtccaa
acacaattgtatgaacaaaatgggcaaggttggatccattggacctggaagacagaaagt
gccgcagactggtcctacgaagccggccttgatggcggatggatcccctgggacgcaggc
tctcatgatgtctccctttcttcgttatgtggctag

DBGET integrated database retrieval system