KEGG   Cryptococcus gattii: CGB_F2130WHelp
Entry
CGB_F2130W        CDS       T02232                                 

Definition
(RefSeq) NADH-ubiquinone oxidoreductase mitochondrial precursor
  KO
K03936  NADH dehydrogenase (ubiquinone) Fe-S protein 3 [EC:7.1.1.2 1.6.99.3]
Organism
cgi  Cryptococcus gattii
Pathway
cgi00190  Oxidative phosphorylation
cgi01100  Metabolic pathways
Module
cgi_M00143  NADH dehydrogenase (ubiquinone) Fe-S protein/flavoprotein complex, mitochondria
Brite
KEGG Orthology (KO) [BR:cgi00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    CGB_F2130W
Enzymes [BR:cgi01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.99  With unknown physiological acceptors
    1.6.99.3  NADH dehydrogenase
     CGB_F2130W
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.2  NADH:ubiquinone reductase (H+-translocating)
     CGB_F2130W
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Complex1_30kDa
Motif
Other DBs
NCBI-GeneID: 10190159
NCBI-ProteinID: XP_003194683
UniProt: E6R7X6
Position
F:join(425720..426151,426196..426365,426410..426473,426524..426718)
Genome map
AA seq 286 aa AA seqDB search
MIRPLLYLLLALSLFLPPTMASRTPLLALRAARAVRAPVRSLSVSARRLQEPSVAPFKEP
VGVNPAKAVAGAQTALHEYGQYILNSLPRYVQQFSVYKDELTLYIPPQAVIPVFTFLRDH
TQCQYRQVVDITAVDFPTKPSRFEVVYHLLSHAHQSRIRVKTYADEVTAVPSVVGLFNGA
NWFEREVWDMYGIFFEGHPDLRRILTDYGFEGFPLRKDFPLTGYTEVRYDDEKKRVVYEP
LQLTQAFRNFNDAASPWEQVGGGDPAVKPEEYKIPPPPEPKKEEKK
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atgattcgtccactgctctacctcttactcgcgctctccctcttcctcccccccacaatg
gccagcagaacccccctcctcgccctccgcgcggcccgtgctgtgcgtgcgcccgtccga
tcgctctccgtgtccgcgcgccggctgcaggagccgtctgttgcgcccttcaaggagccg
gtcggcgtgaaccccgccaaggcagtggccggggcccagaccgcgctgcacgagtacggg
cagtacatcctcaactccctcccccgctacgtgcagcagttctccgtctacaaggacgag
ctcaccctctacatccccccccaggcggtcatccccgtcttcaccttcctcagggaccac
acccagtgccagtaccgccaggtcgtcgacatcaccgcagtcgacttccccacaaagccc
agcaggttcgaggtcgtctaccacctgctctcccacgcccaccagtcccgcatccgcgtc
aagacctacgccgacgaggtcaccgccgtcccctccgtcgtcggcttgttcaatggcgcc
aactggttcgaacgtgaggtctgggatatgtacggcatcttcttcgagggccaccccgat
ctgcgacgtatcttgaccgactatggattcgagggcttccctctgcggaaagactttccc
cttaccggctacacagaggtccgatacgatgacgaaaagaagcgagtcgtctatgaaccc
cttcaactcacccaggcgtttagaaactttaacgatgccgcttctccttgggagcaagtc
ggtggtggtgatcccgcggtcaagcctgaagagtacaaaatccccccgcccccagagccc
aagaaggaggagaaaaagtag

DBGET integrated database retrieval system