KEGG   Cryptococcus gattii: CGB_G0380WHelp
Entry
CGB_G0380W        CDS       T02232                                 

Definition
(RefSeq) lincomycin-condensing protein LmbA
  KO
K00681  gamma-glutamyltranspeptidase / glutathione hydrolase [EC:2.3.2.2 3.4.19.13]
Organism
cgi  Cryptococcus gattii
Pathway
cgi00430  Taurine and hypotaurine metabolism
cgi00460  Cyanoamino acid metabolism
cgi00480  Glutathione metabolism
cgi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cgi00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    CGB_G0380W
   00460 Cyanoamino acid metabolism
    CGB_G0380W
   00480 Glutathione metabolism
    CGB_G0380W
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:cgi01002]
    CGB_G0380W
Enzymes [BR:cgi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.2  gamma-glutamyltransferase
     CGB_G0380W
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.13  glutathione gamma-glutamate hydrolase
     CGB_G0380W
Peptidases and inhibitors [BR:cgi01002]
 Threonine peptidases
  Family T3: gamma-glutamyltransferase family
   CGB_G0380W
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G_glu_transpept
Motif
Other DBs
NCBI-GeneID: 10190822
NCBI-ProteinID: XP_003195035
UniProt: E6R8W4
Position
G:join(108114..108279,108332..108388,108442..108453,108518..108639,108693..108860,108912..108961,109015..109033,109089..109197,109259..109573,109623..109835,109893..110076,110128..110336,110386..110540)
Genome map
AA seq 592 aa AA seqDB search
MTPIDYSRLHPSHEPKFSHFPSRRSTIFSTKGAVATSQPLAAQAGLEILNRGGNAADAAV
ATAAALNVCEPSMTGIGGDVFCLFYDAPSKTVKGVNGSGRAPKALTLEYLRSQGITGDAI
PLTNLNAVTVPGAAAGWLKTIEVFGSGKLSMRQILEPAIRLAREGVPQHELNSNQWQTAE
QLIKEASPNWKEMMMPDGNPPQPSYVMTHNTLADTLEAVAEHGHDGFYKGRIAEAIVDLV
KSGGGVMTLEDLAECTADVIQPISYTFKSHHSPNHEEPSDPGLTLWECPPNGQGITALIA
LGIIEAVEEVHGIDVLEIDHNGKLYLHILIESLRLAFADTRYYVTDPDVEHVPVKELLSK
DYLRKRASLIDLNKASIIEHGMPVQSSDTVYLATADREGNSCSFIASNYAGFGTGAIPKG
CGFTLQNRGTGFTLIEGHPNCVKGGKRPYHTIIPGMVTHGDDLMMSFGVMGGFMQPQGHI
QVLLNKLRGFSSQSTLDAPRFCISAGLPDNGVKNAEQGAGDIDSEIWFEDGIDRKVIEEL
RGMGHQCEIAEGYERKIAGKGQIIQRVVDPNGRRVWACGSDLRGDGCAVGQI
NT seq 1779 nt NT seq  +upstreamnt  +downstreamnt
atgacccccatagattactctcgtcttcatccatctcacgaacctaagttctcacacttc
ccctcgagacgttcaacgatcttctcgaccaagggtgctgtcgcgacatctcagcctttg
gcagctcaggccggcctggagattttgaacagaggcggtaatgcagccgatgctgctgtc
gctaccgcagctgctctcaatgtgtgtgaaccgtcaatgactggtatcggtggagatgtc
ttctgtcttttctatgacgccccaagtaagacggttaagggcgttaacggctcaggtcgt
gctcctaaggctctcacattggaataccttcgttcacagggcataactggcgatgctatt
cccttgactaatctcaacgctgtcacagtccccggtgcggccgccggatggcttaagacg
attgaggtatttggctctggcaaactatctatgaggcaaattctggaacctgccatcagg
ctcgcaagagaaggtgtgccgcaacatgagctgaacagtaatcaatggcagactgccgag
cagcttatcaaggaagcttcccccaactggaaagaaatgatgatgccagacggcaatcct
cctcaaccatcatatgtcatgacacataatactttggcagatactcttgaagcagttgct
gagcatggccatgatggcttttacaaagggcgaattgctgaagccatcgtggatcttgtc
aaaagcggtggaggagtcatgaccttagaggacctcgccgagtgtactgcggacgttata
caacccatctcatacactttcaaatcgcaccattcccccaatcatgaagaacctagtgac
cctgggcttactctgtgggaatgcccgcccaatggacagggcatcactgcactcatagct
ttgggcattatcgaggctgtcgaagaagtacatggtattgacgtgttggagattgaccat
aacggaaagttgtatctgcatattttaatagaatccttgaggctggcgttcgctgatacc
cgatattatgtcactgatccggacgtcgagcatgtgcccgtgaaggaactgctatctaaa
gattatcttcggaagcgtgcatctctcattgacctcaataaagcctcgatcatcgaacat
ggtatgcccgttcagtcatcagacaccgtctaccttgccacggcggatcgagaaggaaac
agttgtagctttattgcttcaaactatgccgggtttggaacaggagctattccgaagggt
tgcggcttcactcttcagaaccgagggactggattcacattgatcgaagggcatcccaac
tgtgtcaaaggcgggaagaggccatatcatactatcatccctggtatggttacccatggt
gatgaccttatgatgtctttcggtgtcatgggagggttcatgcaacctcaaggccacatc
caagttcttctcaacaagcttcgaggcttttctagtcaatctaccctggacgcacctcgt
ttctgtatatcggcaggacttcctgataacggcgtgaaaaacgctgaacaaggtgctggt
gatatcgatagcgagatttggttcgaggacggtatcgaccgaaaagtcattgaggagcta
agagggatgggtcatcagtgcgaaattgcagaaggttacgagcgaaagattgcaggtaag
gggcagattatccaacgggtggtagaccccaacggaagaagggtatgggcatgtggatca
gatttaaggggagacggttgcgctgtcgggcagatttaa

DBGET integrated database retrieval system