KEGG   Cryptococcus gattii: CGB_G4690WHelp
Entry
CGB_G4690W        CDS       T02232                                 

Definition
(RefSeq) hypothetical protein
  KO
K05292  GPI-anchor transamidase subunit T
Organism
cgi  Cryptococcus gattii
Pathway
cgi00563  Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
cgi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cgi00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00563 Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
    CGB_G4690W
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Gpi16
Motif
Other DBs
NCBI-GeneID: 10189135
NCBI-ProteinID: XP_003195314
UniProt: E6R9R7
Position
G:join(918827..919004,919054..919386,919452..919961,920018..920215,920284..920798)
Genome map
AA seq 577 aa AA seqDB search
MLLLSSLKLFLFTPVLFAAGHSPNSFHESLTLHPLPDGKLSVLFEFTTYFTQTKSTASIP
QYHHSITPPSLLLPLQTSNISEISISFVSGRWDQRRTSQSGPLHYLSGGGGGEVRGWVRN
GNEGGSEEERWGAVTHALGGLFCAGLGPKNAGENVKTFGGVYPPRRGDPDGLTHFLLSHP
HHNLCTENLTPFLSLLPSKGLSGLSALLAQPGIIFSWGFQSEGIEVIMPSDGHPEGKWTG
WWEGVVDLIPPGAGVKDAKRETGLESLFKRRLPPSYPEAESSVIRLILPENEKVNVEPQS
RVMGEWRDGKWRQVMEWNAKDSEMVGKDLKFWWDEVRFEYPHTIDPPLISVTKTVIDSQA
SDGTFQIKISNHENIMREAIYSEIWPWWVKGWMSEMAVWIEDEGPRADLLKSISYNPSNP
PDIPPTTIHLSIQLPPRSTLVLTIPFTKLTLKYTDHRPDAERGQEIPAGVLTLLDLVGEQ
GGPEPETKSESSPSSWASPQTNAIRSNRARIYTPRVLLDIPTPDFSMPYNVIIMSSTVMA
VFFGLMHGGLTRKWGWVEVPEEPEEPGEEVRVREEKE
NT seq 1734 nt NT seq  +upstreamnt  +downstreamnt
atgctgctgctgtcgtcgctcaagctttttctgttcacaccggttttgtttgctgcgggt
cacagccccaactcgttccacgagtctctgacacttcaccctttgcctgatggcaagcta
tctgtgttatttgagtttaccacctacttcactcagacgaagtcgactgcctcgattcct
caatatcaccactccatcacccctccatcgctcctcctccctttgcaaactagcaacatc
tccgagatatccatatccttcgtctctggacgctgggatcagcgccgtacatctcaatct
ggacctctacactacttatccggcggaggtggtggcgaagtgagaggatgggtgagaaat
gggaacgagggtggaagcgaggaggagaggtggggggcggtcactcatgcgcttggggga
ttgttctgtgccggcctagggccaaaaaacgcgggcgaaaatgtcaagacttttggaggg
gtataccctccccgtcgaggtgatccggacggcttgacccattttctcctctcgcatcca
catcacaatctctgtacagaaaatctcaccccgttcctctctcttcttccttcgaaaggt
ctttcaggtctctcggccctcctcgcccaaccgggcatcatcttctcctggggtttccaa
tctgaagggatcgaagtcattatgccaagcgacggtcaccctgaaggtaaatggacaggc
tggtgggaaggtgtggtcgacttgattccccccggtgcaggtgtcaaagacgccaagcga
gagacggggctggaaagtctgttcaagaggcgcttaccgccctcctatccagaggcggag
agttcggtgatcaggctgatcctgccagaaaatgaaaaggtcaatgttgagccacaaagc
cgggttatgggagagtggagggatgggaaatggagacaagtcatggaatggaatgcaaag
gatagtgagatggtggggaaagatctaaaattttggtgggatgaagtgaggtttgaatat
cctcatactatcgacccccccctgatttctgttaccaagacggtcattgactctcaagct
tcagatggaacttttcaaatcaagatatccaatcatgaaaacattatgcgggaagcgatc
tacagcgaaatttggccgtggtgggttaaaggttggatgagcgaaatggccgtttggatc
gaagacgagggtccaagagccgacctgctcaaaagcatctcatacaacccctcaaaccca
cccgacattccaccaaccaccatccacctttcaatccagctcccccctagatcgacactt
gtcctcacaatcccattcacaaagcttactctaaaatacactgaccatcgcccagatgct
gagagagggcaggagatcccggcaggggtgttgacacttctcgacctcgttggcgaacaa
ggcggaccagaaccagaaacaaaatctgaatcctcgccatcatcatgggcatcccctcaa
accaacgcgattcgttcaaacagagcaaggatctacacgccgcgcgtcctacttgatatc
cccacaccagacttttcgatgccttataacgtgatcatcatgagttcgacagtgatggct
gtgttttttgggttgatgcacggtggtctcacgaggaagtgggggtgggttgaagtgccg
gaagagcccgaagagcccggagaggaggtaagagtgagggaggagaaggagtag

DBGET integrated database retrieval system