KEGG   Cryptococcus gattii: CGB_G5615CHelp
Entry
CGB_G5615C        CDS       T02232                                 

Definition
(RefSeq) phenylacrylic acid decarboxylase
  KO
K03186  flavin prenyltransferase [EC:2.5.1.129]
Organism
cgi  Cryptococcus gattii
Pathway
cgi00130  Ubiquinone and other terpenoid-quinone biosynthesis
cgi01100  Metabolic pathways
cgi01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cgi00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    CGB_G5615C
Enzymes [BR:cgi01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.129  flavin prenyltransferase
     CGB_G5615C
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Flavoprotein Ral
Motif
Other DBs
NCBI-GeneID: 10189206
NCBI-ProteinID: XP_003195392
UniProt: E6R9Z0
Position
G:complement(join(1121093..1121228,1121292..1121533,1121604..1121768))
Genome map
AA seq 180 aa AA seqDB search
MRRKRYVVAVTGATGATLAIRLLQALRALDIETHLIISKWAVKTLKYETDMIERELKDLA
DYSYSNSDLAAPPSSGSFIHDGMFIIPCSMKTLAAVRIGLGDELISRSADVCLKEGRKLM
LVVRETPLNDIHLENMLFLRRAGAIIFPPVPAYYIRPQTIDDLTNQTVGRILDSSKCSQK
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atgcggagaaaaagatatgtggtcgccgtcacaggagcgacaggtgctactcttgctatc
cgattactacaagcactgagagctctcgatatcgaaacacatctgattatcagcaagtgg
gcagtgaagacgttgaagtacgagactgatatgatagagagagagctcaaagatctcgcc
gactattcatactccaactcagacttagcggcgcctccatcgtctggttccttcatacat
gatggcatgttcatcattccctgcagcatgaaaacacttgctgccgtaaggataggcctt
ggagatgaactcatatcgaggtcagcggacgtttgtctgaaggagggaaggaagcttatg
ttggttgtgagggagacacccctgaacgatatccatttagaaaacatgttattccttcgt
cgagccggtgctatcatctttcctcctgttcctgcatattatataaggccacagacgata
gatgatctcaccaaccaaactgttggacggatattagattccagtaagtgcagccaaaaa
tga

DBGET integrated database retrieval system