KEGG   Cryptococcus gattii: CGB_G6250WHelp
Entry
CGB_G6250W        CDS       T02232                                 

Definition
(RefSeq) coatomer alpha subunit
  KO
K05236  coatomer subunit alpha
Organism
cgi  Cryptococcus gattii
Brite
KEGG Orthology (KO) [BR:cgi00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cgi04131]
    CGB_G6250W
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cgi04147]
    CGB_G6250W
Membrane trafficking [BR:cgi04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Retrieval pathways
   Coat protein complex I (COP-I)
    CGB_G6250W
Exosome [BR:cgi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CGB_G6250W
  Exosomal proteins of bladder cancer cells
   CGB_G6250W
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Coatomer_WDAD COPI_C WD40 ANAPC4_WD40
Motif
Other DBs
NCBI-GeneID: 10189253
NCBI-ProteinID: XP_003195441
UniProt: E6RA21
Position
G:join(1209792..1209809,1209862..1209901,1209962..1210063,1210112..1210231,1210279..1212098,1212148..1212870,1212935..1213261,1213321..1213593,1213655..1213897)
Genome map
AA seq 1221 aa AA seqDB search
MQMLTKFESKSPRVKGIAFHPKQPLLAASLHNGTIQLWNYQMGTLVDRYDEHDGPVRGIC
FHPTQPIFCSGGDDYKIKVWNYKQRKCLFTLTGHLDYVRTVFFHREYPWIISASDDQTIR
IWNWQSRTCIAILTGHNHYIMCAQFHPWDDLVISASMDLTVRVWDISGLRKKNQASQAPM
SAEEQIARASQGQADLFGNTDAVVKYVLEGHDRGVNWASFHPTLPLIVSCGDDRQVKLWR
MSETKAWEVDSCRGHFNNVSMTMFHPKHELILSASEDKTIRAWDMTKRTAVQTFRREHDR
FWVLTAHPELNLFAAGHDNGLIVFKLERERPPFSLSGNQLFYIKDKVVRMADISSGNSQG
ICSVRKFGSQYIPPRTLSYNPAERAVIVTSPSDNGIYELITLPKSTAPTAQDGRDVPSDG
KKGTGFCALFVARNRFAVLDKGAQNIEIKDLSNSITKTIKCPVQTSEIFYGGTASLLLAT
PSSVVLFDIQQQKVIAEINTPPVKYIVWSTDGNMVALLSKHTITIANKSLSQSALIHETI
RIKSAAWDDSGVLIYTTLNHIKYALPQGDNGIIKTLEQPVYLTRVKGSVVHCLDRSAKPQ
AINIDPAEYRFKLALTRKNYDEVLHIIRNSNLVGQSIIGYLQKKGYPEIALHFVQDEQTR
FDLAIECGNLAVALEMARAVDRHDVWERLGAAALQQGNHQIVETAYQKTRNFDKLSFLYL
ITGNTQKLGMMQVIAGKRGDNMSRFQNSLYLGDVRSRVLVLRETGQYPLAYYTAKTNGLD
DLALEILDEAGLTEDDLPPPPQSSGHSSLAPPPIVFSQSDSNWPLKDLGESFFDRALANG
GVDVLLGGEESGEQLDAWAADVPVEEDEVEDEAADEDEGWDLDANVEVPDVEEEFEGEEV
LAEVDLSQGVEPGASEDEIWQNNSALAIDHAAAGAFESAMLLLNKQVGVVNFEPLKPLFL
QAYQHSHVYVPANASLPPLRLNVRRNPETAELRDALPAVPLNYNELKATEVADANKYFAR
GKFVEALATFKSVLSKLLLVVVESEEDAEEIKELVTSCREYVIGLTMEVERRRIAVQDPE
NVVRNLELAAYFTHCELATQHTQLALRSAMKVFSDAGNTATAAVFARRLIETQPSQAVLT
QARAVVSRGQRNPRDVHEIAYDQNTPFNICAATHSPIYEGSSYEESAYSGAKYLPEYKGT
VCLVDGLSQVGLAGSGLRNTV
NT seq 3666 nt NT seq  +upstreamnt  +downstreamnt
atgcagatgctcacaaagtttgaaagcaagtccccaagagttaagggcatagcctttcac
ccaaagcagcccttgctcgctgcgtctttgcataatggaacaatccagctatggaattac
cagatgggtactctggtagaccgatatgatgagcatgatggccctgttcgaggtatctgc
ttccatcccactcaaccgatcttctgttccggtggtgatgactacaagattaaggtgtgg
aattacaaacaaagaaaatgcctctttactctgactggccatctggactatgtccgaact
gttttcttccatcgggaatacccttggatcatctctgcctccgacgaccagactatcagg
atttggaactggcaatctagaacttgtattgccatccttaccgggcacaaccactacatc
atgtgcgcccaattccacccctgggacgacctggtcatctccgcctctatggaccttacc
gtccgtgtatgggacatctccggtctccgtaagaaaaaccaagcttctcaagctcccatg
tctgccgaagaacaaatcgcccgtgccagccagggtcaagctgacttgtttggcaacacg
gatgctgtagtcaagtatgtcctcgagggccacgaccgaggtgtcaattgggcttcattc
catcctacccttcccctcatcgtctcttgtggtgacgatcgccaagtcaagctttggcgt
atgtctgaaaccaaagcctgggaagtggacagctgcagaggtcacttcaacaacgtctcc
atgactatgttccaccccaagcacgagttgattctgagtgcgagtgaggacaaaactatc
agggcttgggatatgacgaaaagaacagccgtccagacgtttagacgagagcacgatagg
ttttgggtgttgactgcccaccccgagctcaacttgtttgctgctggtcacgacaacggt
ctgatagtctttaagctggagcgagagcgtcctcccttctctttatctggcaatcaactt
ttctacatcaaggacaaggttgtccgcatggccgatatctctagcggtaacagccaaggc
atctgttctgtccgcaagtttggctcccaatacatccctcctcggaccctcagctacaat
ccggctgagcgagccgttatcgtgacctctccttccgataacggtatctacgaactcatc
actctgcccaagtctactgcgcctactgctcaggatgggagggatgtgccttcagacggt
aagaagggtactgggttctgtgcgctctttgtggcaaggaacaggtttgcggtcctcgac
aagggggcccagaacattgagatcaaagatctttctaactctatcactaagactatcaaa
tgccctgtacagacctccgagatcttttacggcggtaccgcctcccttttgctggccacg
ccttcctctgttgtccttttcgacattcagcagcaaaaggttattgctgagatcaatacc
cctcccgtcaagtacatagtatggagcacggacggtaacatggtggccctcttgagcaag
cacacaatcactattgccaacaagtctctttctcagagcgctcttatccacgagactatt
cgaatcaagtctgccgcttgggatgacagcggtgtgcttatttacaccactttgaaccac
atcaagtacgctcttcctcaaggtgataacggtatcatcaagacccttgagcagcctgtg
tatctcactcgagttaagggttctgtcgttcactgtctagaccgttccgccaagccacaa
gctattaatattgaccctgccgagtaccgattcaagcttgcccttacccgtaagaactat
gatgaagtcttacatatcattcgaaacagcaaccttgttggtcaaagcatcattggttat
cttcagaagaaagggtatcccgagatcgctctccactttgtgcaagatgaacagactagg
ttcgatctcgctattgaatgtggtaacttagcggttgctttggagatggccagggctgtt
gataggcacgatgtctgggagagactgggtgcggcggccttacagcagggtaaccaccaa
attgtcgagaccgcgtatcagaagactaggaacttcgacaagctctccttcctctacttg
atcaccggcaacacacagaagcttggtatgatgcaagtcatcgctggcaagcggggcgac
aatatgtctagatttcaaaattctttgtacctcggtgatgttcgatcccgtgttttggtc
cttcgcgagactggccagtaccccctcgcttattatactgctaaaaccaacggccttgat
gatcttgccttggagattctcgatgaagccggcttgaccgaggacgacctgccccctccc
cctcagagttctggtcactcttccctcgctcctcctcctatcgtattctcccaatccgac
tccaactggcctctcaaggaccttggcgagagcttctttgaccgagcactcgctaacggt
ggtgttgacgttctgctcggtggtgaagagagtggagaacagttggacgcttgggcggcg
gatgttcctgttgaggaagacgaagtggaggatgaagctgctgatgaggatgaaggatgg
gatcttgatgccaacgtcgaagtacctgatgtcgaagaagagtttgagggagaagaggtt
ttggccgaagtggatttgagtcagggtgttgagcctggtgcgagcgaggatgagatttgg
caaaataactctgcgttggccattgaccatgccgcggccggtgcatttgaatctgccatg
cttttgctcaataagcaagtgggtgtcgtcaatttcgaacccctcaagcctttattcctc
caagcctatcaacactctcacgtctacgttcctgccaatgcctctctccctcctcttcga
ctcaacgttcgccgaaatccagaaaccgctgaactacgcgacgccctgcctgccgttcct
ctcaactacaacgagttgaaagcaaccgaggtggccgatgccaacaagtactttgcccgg
ggtaaatttgttgaggcacttgcgacgtttaagagtgtattatcaaaactcttgttggta
gttgttgaatctgaggaagatgccgaggagatcaaggaacttgtcacctcttgtcgagaa
tacgtcattggtcttactatggaagttgaacgacgacgtattgctgtgcaagatcccgaa
aacgtcgttcgaaaccttgagctcgccgcttactttactcactgcgaacttgctactcaa
catacccaactggcattgcgaagtgcgatgaaggtattctctgatgcgggtaacactgcc
actgctgccgtgtttgctaggaggttgatcgagacccagcctagtcaggctgtccttact
caagcccgtgctgttgtctcccgaggccaacgtaacccacgtgacgttcacgaaatcgcc
tacgaccaaaatacaccattcaatatttgcgctgctacccacagccccatttacgagggc
tcatcatatgaggaaagcgcgtactctggcgccaagtacttgccagagtacaagggtaca
gtctgcctggttgatggattgagccaagtcgggttggctggaagtgggttgagaaacacg
gtttga

DBGET integrated database retrieval system