KEGG   Cryptococcus gattii: CGB_K1470WHelp
Entry
CGB_K1470W        CDS       T02232                                 

Definition
(RefSeq) mitochondrial aspartyl-tRNA synthetase; Msd1p
  KO
K01876  aspartyl-tRNA synthetase [EC:6.1.1.12]
Organism
cgi  Cryptococcus gattii
Pathway
cgi00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:cgi00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    CGB_K1470W
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cgi01007]
    CGB_K1470W
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:cgi03016]
    CGB_K1470W
   03029 Mitochondrial biogenesis [BR:cgi03029]
    CGB_K1470W
Enzymes [BR:cgi01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.12  aspartate---tRNA ligase
     CGB_K1470W
Amino acid related enzymes [BR:cgi01007]
 Aminoacyl-tRNA synthetase
  Class II (A)
   CGB_K1470W
Transfer RNA biogenesis [BR:cgi03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    CGB_K1470W
 Prokaryotic Type
   Other AARSs
    CGB_K1470W
Mitochondrial biogenesis [BR:cgi03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    CGB_K1470W
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_2 tRNA_anti-codon
Motif
Other DBs
NCBI-GeneID: 10185181
NCBI-ProteinID: XP_003196616
UniProt: E6RDE2
Position
K:join(336796..336985,337040..337133,337197..337470,337534..337654,337747..338192,338266..338304,338390..338542,338608..338824,338900..339274,339348..339523)
Genome map
AA seq 694 aa AA seqDB search
MAFRASRSLAALRASSRSTITRTAPRVWGAAASRVLIRGNATATLTPRQIKPLQEVGSLK
AHYGPRPKITHDIADLSPSLVDQKVVIAGWLFSQRRASDNLHFFTLRSPSSSSAVQLVSR
AKDVSSDMMEYPLESVVLAQGTVRARKQKAKTASSAIDEIELEVQGVTLLNPADQTLPFY
PNRPEVANEDLRAQHRYLDLRRQDLANNLQTRGKVAHIIRNYLYDQGFTEIETPILLNSS
PEGAREFLVPTRSPSSEGGQPTFYALPQSPQQPKQLLISSGAIPKYYQIAKCFRDEDGRK
DRQPEFTQIDLEMGFVSGAAEQPKGEGQMRSTWAIGGQEVREVVEGMIKKIWKEVKGVDL
EGWFRVMPYEVAMDVYGSDKPDTRFEMYTLPIGYYPTLSDNSLDKVLLDQSPYTVEWMVT
PAAQAAGLDISSIAASSSFVDYVKITNANTHSWLGESVLTASLGLSLDKSLPGGVNPGDV
VWLSRRKKIAEGGWTHLGRLRVRLMEELVAKGLMTLPTQPHFLWITQFPLFTLADEDKIH
LSRGRYSSTHHPFTAPMYEDLADLKAGKVDGVRGQHYDLVLDGQEIGGGSVRIHDVKLQE
WVMKEVLQLDEQEMSRFDHLLRALKCGAPPHGGLALGFDRLVAILCGAKSIREVIAFPKS
TTGQDPVFKSPSVSGDEVLKEYGLQSLKREDKKE
NT seq 2085 nt NT seq  +upstreamnt  +downstreamnt
atggcattcagagcgtcaagatcgcttgcagctctcagagcgtcttcgaggagcaccatt
actaggacagctccacgagtttggggtgcagcagcgtctcgagtgctcattcgaggtaac
gcaacagcgacacttacaccgagacaaatcaaacctttacaagaggtggggagtttaaaa
gcccattacggtcctcgaccaaagataacgcacgatatcgcagatctttccccttcactc
gtcgaccaaaaagtcgtcatcgcaggctggctcttctcccaacgacgagcatctgataac
ctccatttcttcacccttcgctcaccgtcctcttcttcggcagtgcaactcgtttctcga
gccaaggatgtttccagcgatatgatggaataccccctcgaaagcgtcgtgctcgcccag
gggactgtcagagctaggaaacaaaaggccaaaacagccagctcggctattgatgagatt
gagctagaggtgcaaggtgtgacattgttgaaccctgcagaccaaactttgccattctat
cccaacagacccgaagttgccaacgaagaccttcgagctcagcatcgttaccttgacctt
cgacgacaggaccttgcgaataatctccagaccaggggcaaggttgcgcacattatccga
aactatctctacgatcaaggattcaccgaaatcgaaacacccatcttactcaactcatcc
cccgaaggtgctcgagaattcctcgtccctacccgatccccctcctctgaaggcggccaa
cccacattctacgcactccctcaatcacctcaacaaccgaaacagctcctcatttcgtct
ggcgctatccccaagtactaccaaatcgcgaaatgtttccgtgatgaagacgggaggaag
gataggcagcccgagtttacgcagattgatttggaaatgggtttcgtgagtggagcggct
gagcagccaaagggagaaggtcaaatgaggagtacgtgggcgattggagggcaagaagtt
agggaggtggtggaagggatgatcaagaagatttggaaagaagtaaaaggtgttgatttg
gagggatggttcagggttatgccgtatgaagtggctatggatgtatatgggtctgataag
ccggacaccaggtttgagatgtatactttacctataggctattacccaacactctccgac
aattctcttgacaaggtccttcttgaccaaagtccatacactgttgaatggatggtcacg
cccgctgcgcaagcagctggtcttgacatttcttccatcgctgctagcagctctttcgtt
gattatgtcaaaatcacaaacgccaacacccattcatggctcggtgaatccgtcttgacc
gcttccctcgggctgagtttggacaaatctttgcctggtggtgtgaaccccggcgatgta
gtttggttatcgaggaggaagaagattgcagaaggcggatggactcatttgggaagatta
cgcgtacggctcatggaagagcttgtcgccaaaggcttgatgacgctgcctacccaaccg
cactttctctggatcacacaattcccgctattcaccctcgctgacgaagacaagatccac
ctctcccgcggacgatactcttccacccaccacccattcaccgcgcccatgtacgaagat
ctcgccgatctgaaagccggtaaagtcgacggcgtcaggggacagcactatgatttagtg
ttggatggacaggaaattgggggagggagtgtgaggatacatgatgtcaagttgcaggaa
tgggtgatgaaggaggtgttgcagttggatgaacaagagatgagcagatttgatcatctt
ttgagagcgttgaaatgtggtgcgcccccacatggtggtcttgctctcggctttgaccga
ctggtggccattctgtgcggagcaaaatctatacgcgaggtgattgcgttccccaagagc
actacaggtcaagatccagtgttcaaatcaccttctgtctctggggatgaggtgttgaaa
gaatatggactacagagtctgaaaagggaagataagaaggaatag

DBGET integrated database retrieval system