KEGG   Cryptococcus gattii: CGB_K1660WHelp
Entry
CGB_K1660W        CDS       T02232                                 

Definition
(RefSeq) hypothetical protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
cgi  Cryptococcus gattii
Pathway
cgi00480  Glutathione metabolism
cgi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cgi00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    CGB_K1660W
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cgi02000]
    CGB_K1660W
Enzymes [BR:cgi01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     CGB_K1660W
Transporters [BR:cgi02000]
 Other transporters
  Pores ion channels [TC:1]
   CGB_K1660W
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MAPEG
Motif
Other DBs
NCBI-GeneID: 10185173
NCBI-ProteinID: XP_003196627
UniProt: E6RDG1
Position
K:join(384414..384485,384549..384653,384702..384780,384837..384904,384958..384990,385055..385094,385145..385203)
Genome map
AA seq 151 aa AA seqDB search
MSAITLPPAFPVVGIPLFATFALNTYQQILVSKARKESGIKYPTLYAPEAEAAVDARKMK
FNCCQRAHANTLENVPYVLGLFGFLSVFHPKVASAAMLMWIVGRFHYTAGYASGDPEKRI
NTIYKISYLGLFTLVFGTLGVAVQKSYSVLF
NT seq 456 nt NT seq  +upstreamnt  +downstreamnt
atgtctgccatcacccttcctcccgctttccctgtcgtcggtatccctcttttcgctacc
tttgctctcaacacttatcagcaaatccttgtctcgaaggcccgtaaggagtctggcatc
aagtaccctacattatatgccccggaggccgaggctgctgtcgatgccagaaagatgaaa
ttcaactgctgccagcgtgctcacgccaacactctcgagaatgttccctacgttctcggt
ctctttggtttcctcagtgttttccaccccaaggtcgcctccgctgctatgcttatgtgg
attgttggccgcttccattataccgcgggctacgcttccggtgaccctgaaaagcgcatc
aacaccatctacaagatctcttacctcggtcttttcactcttgtcttcggaactcttggt
gttgcagttcagaagagctattctgtgctcttctaa

DBGET integrated database retrieval system