KEGG   Cryptococcus gattii: CGB_K4430CHelp
Entry
CGB_K4430C        CDS       T02232                                 

Definition
(RefSeq) beta-fructofuranosidase
Organism
cgi  Cryptococcus gattii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C
Motif
Other DBs
NCBI-GeneID: 10185366
NCBI-ProteinID: XP_003196854
UniProt: E6RE15
Position
K:complement(join(979812..980012,980128..981254,981304..981370,981426..981590))
Genome map
AA seq 519 aa AA seqDB search
MFRSLVPITIAGLAYLLQSPAQSTTSSAASVPTGVPIEGDYSGPYRPRIHFSPPKGFMND
PNGLHRDSNGTWHLYYQYNPTDIVAGNQHWGHATSPDLYHWTNQPIALFPPNSSSGVFSG
SAVIDTNNTSGFFPDQDNGVVAIYTLNTPTAQVQQIAYSKDGGYSFEEYEGNPVLDVGLT
QFRDPKVIWYEDHWVMAVAFPVDFVIGIYTSPDLKSWTHASNVTHVGFLGLQYECPNLVS
VPIANSSDSAWVLTISINPGSPLGGSITQYFPGEFNGTHFTPFDSAARLTNFGKDDYAGQ
FFYDEPVSIGWASNWQYTNFVPTGEEGWRSAMTVPRRNYLANMSTAGWDLVQEVYDLSPV
VGDQLDTQQLVNKSSTATFTEGAYIDINFTIPDGASFAEYASLNFTISTSSTGETVKGGY
FFADPYSIAVWLDRGDTKAFESPFFTDKFSVAPAHLAKRLQVIIDRSVVEIYIDNGALVG
TMVVFPEEPFTKLEVTTAGMPDESEVEFGVWDLKDAWTS
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atgtttcgctctctcgtccccattaccatcgcgggtctggcatatctccttcagagtcca
gctcaatcgacaacgtcaagtgctgcctctgtccccacgggcgttcccatcgaaggagac
tactctggaccttaccgccccagaattcatttctcacccccgaaaggctttatgaacgat
ccaaacggtctgcacagggatagcaacggaacttggcatctgtactaccagtacaaccca
accgacattgtagccggtaatcaacactggggtcatgccacctctcctgacctctaccac
tggaccaatcagcctattgccctcttccctcccaattcttcctcgggcgtcttttctggt
tcggccgtcattgataccaataatacttctggcttcttccctgatcaagacaatggggtt
gtagccatctacaccctcaatactcccactgcccaggtccagcagattgcctactccaaa
gatggtggctattccttcgaagaatacgaaggtaatcctgtcttagatgtcggattgact
cagttccgtgaccccaaagttatctggtacgaggaccattgggtcatggccgtcgccttc
cccgtggacttcgtcattggcatctatacctctccggacctcaaatcatggacacatgcc
tctaacgtcactcatgtcggtttcctcggccttcaatacgaatgtcctaacctcgtatcc
gtcccaatcgccaattcctctgactccgcatgggtactcactatctccattaaccctggt
tcaccacttggggggtctatcacccaatatttccccggggagtttaacggtacccacttt
actccttttgattctgctgcaagattgacaaactttggaaaggacgactatgccggtcag
ttcttctatgacgagcctgtcagtatcggatgggcgtccaactggcagtataccaacttt
gtgcccacaggcgaagaaggttggaggagtgcgatgacagtgccaaggaggaactatctt
gcaaacatgtctaccgctggatgggatctcgtccaagaagtgtacgacctttctcctgtc
gtcggggaccaacttgatactcaacagctcgtcaacaagtcctccactgctactttcacc
gagggggcatatattgatatcaattttaccatccctgacggtgcttctttcgcggaatat
gcttcgctcaattttaccatttcaacgagcagcacgggtgagacggtgaaagggggttac
tttttcgcggatccttattccatcgccgtgtggcttgataggggagatacaaaagcattc
gaaagcccttttttcaccgacaagttctcagttgcccctgctcacctagcaaaaagactc
caagtcatcatcgatcgcagcgtggtcgagatttacatcgataacggggcattggttggc
acaatggttgttttcccagaggaaccattcacaaagcttgaggttaccacagcaggaatg
cccgatgagagcgaggttgaatttggggtttgggatttgaaagatgcttggacgtcgtga

DBGET integrated database retrieval system