KEGG   Corynebacterium glutamicum ATCC 21831: AR0_06075Help
Entry
AR0_06075         CDS       T03361                                 

Definition
(GenBank) SAM-dependent methyltransferase
  KO
K00563  23S rRNA (guanine745-N1)-methyltransferase [EC:2.1.1.187]
Organism
cgj  Corynebacterium glutamicum ATCC 21831
Brite
KEGG Orthology (KO) [BR:cgj00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:cgj03009]
    AR0_06075
Enzymes [BR:cgj01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.187  23S rRNA (guanine745-N1)-methyltransferase
     AR0_06075
Ribosome biogenesis [BR:cgj03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    AR0_06075
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_11 Methyltransf_25 Methyltransf_23 Methyltransf_12 Methyltransf_32 Methyltransf_31 Ubie_methyltran
Motif
Other DBs
NCBI-ProteinID: AIK87587
Position
1240257..1241123
Genome map
AA seq 288 aa AA seqDB search
MLSHIIDVLADPIDGTPLVGAEDFSRLVSESGHSYDVARQGYVTLAGGAGLRYSGDDAQM
IADRETFLSGGHFAPFVEAVTEHVQDVVDQAGLSDDAQPVVCEIGAGTGYYLSHTLDSVA
GSRGIGIDVSVHAAKRLAKCHPRVGAVIADAWARLPIADNSVDAITVIFAPRNAAEFARI
LKPKGQVIVLTADTGHLAELREPLGIIDVEAGKVDRMIEQASGHLKPVGESDLVEFEMLL
DQKSIASQIGMSPSARHIKPEALAERIAALPEQMKVTARAKITRLERI
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
gtgctttcccacatcattgatgtcctcgccgacccgatcgatggcaccccacttgtaggc
gccgaagatttctcacggttggtgtctgaatctgggcattcctacgatgttgctcgtcaa
gggtatgtcaccctggctggtggcgcaggtctgcgctattcaggcgatgatgcacagatg
atcgcggatcgggaaaccttcctttctggcggtcacttcgcgcccttcgtggaagctgtc
accgagcatgttcaagatgtcgttgaccaggcaggccttagcgatgacgcacagccagtg
gtctgcgaaatcggcgcgggtaccggctactacttgtcccatacccttgattctgttgca
ggatctcgcggaattggcattgacgtttccgtgcacgccgcaaagcgtttggcaaagtgt
caccctcgcgtcggcgcagtcatcgcggacgcatgggcacgcctgcccattgcagataac
tctgtcgatgccatcacggtgattttcgcaccacgcaacgctgcggaatttgcccgcatt
ttgaagccaaagggacaggtcatcgtgcttaccgcagataccggccacttggctgagctt
cgtgaaccactgggcatcattgatgtggaggccggcaaagttgatcgcatgatcgaacaa
gcgtcaggccacctcaagccagttggcgaaagcgacttggtggaatttgaaatgctgctg
gatcaaaaatccattgcatctcagatcggtatgagcccttctgcacgccacattaagcct
gaggctttggcggaacgcatcgccgctctaccagaacaaatgaaggttacagcccgggcc
aagatcaccaggctggaacgcatctaa

DBGET integrated database retrieval system