KEGG   Corynebacterium glutamicum ATCC 21831: AR0_06795Help
Entry
AR0_06795         CDS       T03361                                 

Definition
(GenBank) glutamyl-tRNA amidotransferase
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
cgj  Corynebacterium glutamicum ATCC 21831
Pathway
cgj00970  Aminoacyl-tRNA biosynthesis
cgj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cgj00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    AR0_06795
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:cgj03029]
    AR0_06795
Enzymes [BR:cgj01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     AR0_06795
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     AR0_06795
Mitochondrial biogenesis [BR:cgj03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    AR0_06795
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey YqeY ScsC_N
Motif
Other DBs
NCBI-ProteinID: AIK87729
Position
1409853..1411358
Genome map
AA seq 501 aa AA seqDB search
MTAAFYDLMDFDEVLEKYDPVMGLEVHVELGTETKMFSASSAHFGAEPNSNVDPVSLGLP
GALPVVNAKGVEWAIKIGLALNCSIAESSRFARKNYFYPDQPKNYQISQYDEPIAYDGYL
DVVLEDGTEWRVEIERAHMEEDTGKLTHLGGTSGRIHGATASLVNCNRAGIPLIEVVTKP
IEGAGARAPEIAKAYVSALRDLVKALGVSDGRLDQGSMRVDANLSLRPIGQEEFGTRTET
KNINSLKSVEQAITFEMQRQAQVLDDGGVIDQETRHYQEADGSTSKGRPKETAEDYRYFN
DPDLPPVIAPREWVEEIRATLPELPWVRRARIQEEWKLSDAEMRDLINANALDLIIETVE
AGTTPDEARAWWVSYISQKANESGVELDALGVAPAHVARVVALVSEGKLTNKLARQAIDG
VIAGEGDVDAVVAARGLEVVRDDGAIEKAVDDALAANPDIVEKYRAGNTKVTGAIVGAVM
KATRGKADPAQVNQLIAKKLA
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgactgcagccttttatgatctgatggacttcgatgaagttctagagaaatatgacccg
gtgatgggacttgaggtccacgtcgaactgggcactgagaccaagatgttctctgcatct
tctgcacactttggcgctgaacccaatagcaatgttgacccagtttctttgggtctccca
ggcgcacttcctgtggttaacgccaagggcgtggagtgggcaattaagattggactggcg
ctgaactgcagcatcgctgagtcctcacgctttgcacgtaagaactacttctacccggat
cagcctaagaactaccagatctcccagtatgacgagccaatcgcatacgacggctacctg
gatgttgttctggaggacggcaccgagtggcgtgtggaaatcgaacgcgctcacatggag
gaagacaccggaaagctcacccacctgggtggtacttctggtcgtattcacggcgcaacc
gcttctttggtgaactgcaaccgtgcaggcatccctctgattgaggttgtcaccaagcca
atcgaaggcgctggcgctcgcgctccagagatcgctaaggcttatgtctccgcactgcgc
gatctggttaaggcgctcggcgtgtccgacggccgcttggatcagggttctatgcgtgtc
gacgccaacctgtccctgcgcccgatcggccaggaggaattcggcacccgtaccgaaacc
aagaacatcaactccctgaagtccgttgagcaggccatcacctttgagatgcagcgccag
gctcaggtactggacgacggtggtgtgattgatcaggaaacccgccactaccaggaggcc
gacggaagtacttccaagggtcgtccaaaggaaaccgctgaagattaccgttacttcaac
gatcctgacctgcctccagtgatcgcgcctcgcgagtgggtggaagaaatccgcgcaact
cttccagagctgccttgggttcgccgtgcacgcatccaggaagagtggaagctttccgac
gccgagatgcgcgacctcatcaacgccaacgcgctcgacctcatcatcgagaccgtggaa
gcaggtaccactcctgatgaagctcgtgcttggtgggtttcttacatctcccagaaggcc
aacgagtccggcgttgagctcgacgctctcggtgttgcgccagctcacgttgcccgcgtt
gtcgctcttgtttctgaaggcaagctgaccaataagctggcacgtcaggctatcgacggc
gttattgctggcgaaggcgacgttgacgcagttgttgctgctcgtggactggaagttgtt
cgcgatgacggcgcaattgaaaaggctgtcgatgatgccttggccgcaaacccagacatc
gtggagaagtaccgcgctggcaacaccaaggtcaccggcgccatcgttggtgctgtcatg
aaggcgacccgcggtaaggctgacccagctcaggtgaaccagctgatcgcaaagaagttg
gcttaa

DBGET integrated database retrieval system