KEGG   Corynebacterium glutamicum ATCC 21831: AR0_11150Help
Entry
AR0_11150         CDS       T03361                                 

Definition
(GenBank) malate synthase
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
cgj  Corynebacterium glutamicum ATCC 21831
Pathway
cgj00620  Pyruvate metabolism
cgj00630  Glyoxylate and dicarboxylate metabolism
cgj01100  Metabolic pathways
cgj01110  Biosynthesis of secondary metabolites
cgj01120  Microbial metabolism in diverse environments
cgj01200  Carbon metabolism
Module
cgj_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:cgj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AR0_11150
   00630 Glyoxylate and dicarboxylate metabolism
    AR0_11150
Enzymes [BR:cgj01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     AR0_11150
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase
Motif
Other DBs
NCBI-ProteinID: AIK88542
Position
complement(2347352..2349571)
Genome map
AA seq 739 aa AA seqDB search
MTEQELLSAQTADNAGTDSTERVDAGGMQVAKVLYDFVTEAVLPRVGVDAEKFWSGFAAI
ARDLTPRNRELLARRDELQMLIDDYHRNNSGTIDQEAYEDFLKEIGYLVEEPEAAEIRTQ
NVDTEISSTAGPQLVVPILNARFALNAANARWGSLYDALYDTNAIPETDGAEKGKEYNPV
RGQKVIEWGREFLDSVVPLDGASHADVEKYNITDGKLAAHIGDSVYRLKNRESYRGFTGN
FLDPEAILLETNGLHIELQIDPVHPIGKADKTGLKDIVLESAITTIMDFEDSVAAVDAED
KTLGYSNWFGLNTGELKEEMSKNGRIFTRELNKDRVYIGRNGTELVLHGRSLLFVRNVGH
LMQNPSILIDGEEIFEGIMDAVLTTVCAIPGIAPQNKMRNSRKGSIYIVKPKQHGPEEVA
FTNELFGRVEDLLDLPRHTLKVGVMDEERRTSVNLDASIMEVADRLAFINTGFLDRTGDE
IHTSMEAGAMVRKADMQTAPWKQAYENNNVDAGIQRGLPGKAQIGKGMWAMTELMAEMLE
KKIGQPREGANTAWVPSPTGATLHATHYHLVDVFKVQDELRAAGRRDSLRNILTIPTAPN
TNWSEEEKKEEMDNNCQSILGYVVRWVEHGVGCSKVPDIHDIDLMEDRATLRISSQMLAN
WIRHDVVSKEQVLESLERMAVVVDKQNAGDEAYRDMAPNYDASLAFQAAKDLIFEGTKSP
SGYTEPILHARRREFKAKN
NT seq 2220 nt NT seq  +upstreamnt  +downstreamnt
atgactgaacaggaactgttgtctgctcagactgccgacaacgctggaactgacagcacc
gaacgcgttgacgcgggcggaatgcaggttgcaaaagttctctacgactttgtaaccgaa
gcggtactccctcgcgtgggtgtggatgcggaaaagttctggtccggattcgccgccatc
gcccgggacctcaccccacgcaaccgcgagctgcttgctcgccgcgatgaactgcagatg
cttatcgacgactaccaccgcaacaactccggcaccatcgaccaagaggcgtacgaggat
ttcctcaaagaaatcggatacttggttgaggagccagaagctgcagaaatccgtacccaa
aacgtcgatacggaaatctccagcaccgcaggacctcagctggttgttccaattctgaac
gcacgcttcgcgctgaacgctgccaatgctcgctggggttccctctacgatgcgttgtac
gacaccaacgccatcccagaaactgatggcgctgaaaagggcaaggagtacaacccggtc
cgcggccagaaggtcatcgagtggggtcgtgaattcctcgacagcgttgtcccactggac
ggtgcttcgcatgccgatgttgaaaagtacaacatcaccgatggaaagcttgcagcccac
attggagatagcgtctaccgactgaaaaaccgtgaatcctaccgtggcttcaccggcaac
ttccttgatccagaagcaatcctgctggaaaccaacggcctgcacatcgagctgcagatc
gatcctgtccacccaatcggcaaggcagacaagactggtctcaaagacatcgttttggaa
tctgcgatcaccacgatcatggacttcgaagactccgttgcagctgttgatgctgaagac
aagaccttaggttactctaactggttcggactcaacaccggcgaactgaaagaagagatg
tccaagaacggacgcatcttcacccgtgagctcaacaaggaccgcgtctacattggccgc
aatggtaccgagctggttctgcacggtcgttccctactgttcgtccgcaacgttggtcac
ctcatgcaaaacccatccatcttgattgatggcgaggagatcttcgaaggcatcatggat
gctgtcttgaccactgtttgtgccatcccaggaattgctccgcagaacaagatgcgcaat
tcccgcaagggctccatctacatcgtgaagcctaagcagcacggccctgaagaagtcgcg
ttcaccaacgagctcttcggccgcgttgaggatctgcttgatctgccacgccacaccttg
aaggttggtgttatggatgaggagcgtcgcacgtccgtgaacctggatgccagcatcatg
gaagttgctgaccgcttggcattcatcaacactggcttcctggaccgcaccggcgatgaa
atccacacctccatggaagcaggcgccatggtgcgcaaggctgatatgcagaccgcaccg
tggaagcaggcctacgagaacaacaacgttgatgcaggtattcagcgtggtcttccaggc
aaggctcagatcggtaagggcatgtgggcgatgactgaactcatggcagaaatgctggag
aagaagatcggccagccacgcgaaggcgccaacactgcatgggttccttcaccaactggt
gcgacgctgcacgcaacgcactaccacttggttgatgtgttcaaggttcaagacgaactg
cgtgctgccggccgccgcgacagcctgcgcaacattctcaccattccaaccgcaccaaac
accaattggtctgaggaagagaagaaggaagagatggacaacaactgccagtccatcctc
ggatacgttgtgcgctgggttgagcacggtgttggttgctccaaggttccagacatccat
gacatcgacctcatggaagaccgcgcaacgctgcgtatttcctcgcagatgctggccaac
tggatccgccatgatgttgtctcgaaggagcaggtcttggagtcactggaacgaatggca
gtggtcgtcgacaagcaaaatgcgggcgacgaggcctaccgcgatatggcgccgaactac
gacgcctccctcgccttccaggcggctaaggacttgattttcgaaggcaccaagtcccca
tcgggctacaccgagcccatcttgcacgcacgccgccgcgagttcaaagcaaaaaactaa

DBGET integrated database retrieval system