KEGG   Corynebacterium glutamicum ATCC 21831: AR0_11455Help
Entry
AR0_11455         CDS       T03361                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
cgj  Corynebacterium glutamicum ATCC 21831
Pathway
cgj00071  Fatty acid degradation
cgj00072  Synthesis and degradation of ketone bodies
cgj00280  Valine, leucine and isoleucine degradation
cgj00310  Lysine degradation
cgj00362  Benzoate degradation
cgj00380  Tryptophan metabolism
cgj00620  Pyruvate metabolism
cgj00630  Glyoxylate and dicarboxylate metabolism
cgj00640  Propanoate metabolism
cgj00650  Butanoate metabolism
cgj00900  Terpenoid backbone biosynthesis
cgj01100  Metabolic pathways
cgj01110  Biosynthesis of secondary metabolites
cgj01120  Microbial metabolism in diverse environments
cgj01130  Biosynthesis of antibiotics
cgj01200  Carbon metabolism
cgj01212  Fatty acid metabolism
cgj02020  Two-component system
Brite
KEGG Orthology (KO) [BR:cgj00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    AR0_11455
   00630 Glyoxylate and dicarboxylate metabolism
    AR0_11455
   00640 Propanoate metabolism
    AR0_11455
   00650 Butanoate metabolism
    AR0_11455
  Lipid metabolism
   00071 Fatty acid degradation
    AR0_11455
   00072 Synthesis and degradation of ketone bodies
    AR0_11455
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AR0_11455
   00310 Lysine degradation
    AR0_11455
   00380 Tryptophan metabolism
    AR0_11455
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AR0_11455
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AR0_11455
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    AR0_11455
Enzymes [BR:cgj01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     AR0_11455
Exosome [BR:cgj04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AR0_11455
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AIK88602
Position
2412220..2413446
Genome map
AA seq 408 aa AA seqDB search
MNPQDIVICSPLRTPVGAYGGSFTGVPVEELATTVINAIVEATGITGDDVDDLILGQASP
NGAAPALGRVVALDSKLGQNVPGMQLDRRCGSGLQAIVTAAAHVASGAADLVIAGGAESM
SRVEYTVSGDIRWGVKGGDMQLRDRLAEARETAGGRNHPIPGGMIETAENLRREYGISRE
EQDKISAASQQRWGKAADAGLFDDEIVPVTVPAKKRGQEPTIVSRDEHGRPGTTVEKLAA
LRPIMGRQDAEATVTAGNASGQNDGAAAVIVTTRAKAEEKGLRPVMRLAGWSVAAVPPET
MGIGPVPATKKVLDRLGLTLEDIGAIELNEAFAAQALSVLKEWNISWEDERVNPLGSGIS
MGHPVGATGARMAVTLAHRMQRENTQYGLATMCIGGGQGLAAVFEKEN
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgaaccctcaagatattgtcatctgttccccattgcgcaccccagttggtgcttacggc
ggatccttcaccggcgtccctgttgaagaattggccaccaccgtgatcaacgcgatcgtt
gaggcaaccggcatcaccggcgacgatgtggacgatctgatcctcggccaggcatccccc
aacggtgcggctccagcactgggccgtgttgttgctctagattccaagcttggccaaaac
gttccaggcatgcagcttgatcgccgctgtggttccggcctgcaggcaatcgtcaccgct
gctgcacacgttgcatccggcgctgctgatctggtcatcgcaggtggcgcggaatccatg
agccgcgttgagtacaccgtgtccggcgatatccgttggggtgtcaagggcggcgacatg
cagcttcgtgaccgccttgcagaagcacgcgaaaccgctggcggacgcaaccacccgatc
cctggtggaatgatcgagaccgctgagaacctgcgtcgcgaatacggcatctcccgcgag
gagcaggacaagatctccgcagcgtcccagcagcgttggggcaaggctgctgatgcgggg
cttttcgacgacgagatcgtgccagtcaccgtccctgccaagaagcgcggccaggagcca
accatcgtttctcgtgacgagcatggtcgaccaggaacaaccgtcgaaaagcttgctgct
ttgcgccccatcatgggccgccaggatgcggaagcaaccgtcaccgctggcaacgcgtcc
ggccaaaatgatggcgctgctgccgtcatcgtgaccactcgcgccaaggccgaggagaag
ggcctgcgcccagtcatgcgtttggctggctggtccgtggctgctgttcccccagagacc
atgggtattggacctgttcctgccaccaagaaggtcctggatcgtttgggccttaccctg
gaggacatcggcgcgatcgaactcaacgaagctttcgcagctcaggcactgtctgtgctg
aaggaatggaacatttcttgggaagatgagcgcgtcaacccactgggttccggtatttcc
atgggacacccagtcggtgccaccggtgctcgcatggcagtaaccttggctcaccgcatg
cagcgtgaaaacactcagtacggactggccaccatgtgcatcggtggcggccagggtctt
gcagctgtctttgaaaaggagaactaa

DBGET integrated database retrieval system