KEGG   Corynebacterium glutamicum ATCC 13032 (Kyowa Hakko): NCgl0402Help
Entry
NCgl0402          CDS       T00102                                 

Gene name
hemA
Definition
(RefSeq) glutamyl-tRNA reductase
  KO
K02492  glutamyl-tRNA reductase [EC:1.2.1.70]
Organism
cgl  Corynebacterium glutamicum ATCC 13032 (Kyowa Hakko)
Pathway
cgl00860  Porphyrin and chlorophyll metabolism
cgl01100  Metabolic pathways
cgl01110  Biosynthesis of secondary metabolites
cgl01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cgl00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    NCgl0402 (hemA)
Enzymes [BR:cgl01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.70  glutamyl-tRNA reductase
     NCgl0402 (hemA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GlutR_N Shikimate_DH GlutR_dimer OCD_Mu_crystall Sacchrp_dh_NADP Glu_dehyd_C ApbA DnaJ-X F420_oxidored 3HCDH_N ThiF
Motif
Other DBs
NCBI-GeneID: 1021437
NCBI-ProteinID: NP_599664
UniProt: P0C543
Position
438513..439907
Genome map
AA seq 464 aa AA seqDB search
MVSVLIVGMSHRSAPVSLLERLSMDDSVRGETTQALLGRASLSEALIVSTCNRLEVYTVT
SSFHTGVNDVVEVLHEASGVDIETLRGYLYVRYADAAAEHMLVVTSGLDSMVLGEQQIIG
QVRTAYQAANEYGSVGPALHSLTQTALHTGKRVHSETAIDDAGASMVSFAVDRALVQMGL
DSEAEAPLSGKTALVLGAGAMSSLAATHLGRAGISNLIMANRTLERAERLAEHSLEAGVP
AEVVEYDQRASAYNRVDLVVSATGADDFTVKPEDIPEGASLMLVDLSMPRDIDDACADLP
GVDLVNIERLHKASREGGSGMAPSEEEALAIVREELDSFTSEQRIRDIVPAVSALRRQAA
SVGSDELDRLRQRAPGISEVEWGEVEKTVRRVVDKLLHEPTVRVKELAARSGSISYDSAL
QELFGLESLASTAAPATTSVNASELPDAGIVAFVNAPSATQTRE
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atggtgagtgtactcatcgtagggatgtcgcacaggtctgcgcctgtgtcgcttcttgaa
cgtctgagcatggatgattcagtacgtggtgaaacaactcaagcactcctgggtagggcg
tctttaagcgaggccctcattgtctctacgtgtaaccgcctggaggtctacaccgtcact
agcagtttccatactggtgttaatgatgtggtggaggttctccatgaggcaagtggcgta
gatattgaaactttgcgcggatatctttatgtccgttacgccgatgctgctgctgaacac
atgttggtggtgacttccgggttggattccatggtgttgggtgagcagcagatcattggt
caggtgcgcactgcgtaccaagcagctaatgaatatggttctgtcggtcctgctttgcat
tcacttacccagaccgcgctgcataccggcaagcgcgtgcattcggagactgctattgat
gatgctggtgcatcgatggtgtctttcgctgtggatcgcgcgttggtgcagatgggtctt
gattcggaggcagaagccccactatctggcaagacagccttggtgttgggcgctggcgcg
atgagttctcttgcagccactcaccttggtcgcgctggaatttccaacttgatcatggcc
aaccgcactctggaacgtgccgaaaggcttgcggagcattccctagaagccggagttcct
gcagaggttgtggaatacgatcagcgagcttccgcctacaatcgcgttgacctggtagtt
tccgccacgggagcggatgatttcaccgtgaagcctgaggatattccagaaggtgcttcg
ttgatgttggtggatttgtccatgccacgagacatcgatgatgcttgtgcggatctgccg
ggcgttgatttggtgaacatcgaacgcctgcacaaggcctcccgtgagggtggatcgggc
atggcgccaagcgaggaagaagctttggcgattgttcgggaagagttggattctttcacc
tctgagcagcgcattcgcgatatcgttccagctgtgtccgcgttgcgcaggcaggccgcg
tcggtgggaagcgatgaattggatcgactccgccaacgtgcccccgggatttccgaggtg
gaatggggggaagtggagaaaacagtgagacgggtcgtcgataagcttcttcatgaaccc
actgtgcgcgtcaaggaactggcggcccggtccggcagcatctcttatgattcagctctg
caagagctgttcggtttggagtcgctggcgagcaccgcagcaccggcaaccacgtccgtc
aacgcgtcagaactgccggatgcgggtatcgtcgcattcgtgaacgcaccttctgccaca
caaacgagggagtaa

DBGET integrated database retrieval system