KEGG   Corynebacterium glutamicum ATCC 13032 (Kyowa Hakko): NCgl0416Help
Entry
NCgl0416          CDS       T00102                                 

Gene name
Cgl0431
Definition
(RefSeq) delta-aminolevulinic acid dehydratase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
cgl  Corynebacterium glutamicum ATCC 13032 (Kyowa Hakko)
Pathway
cgl00860  Porphyrin and chlorophyll metabolism
cgl01100  Metabolic pathways
cgl01110  Biosynthesis of secondary metabolites
cgl01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cgl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    NCgl0416 (Cgl0431)
Enzymes [BR:cgl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     NCgl0416 (Cgl0431)
Exosome [BR:cgl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   NCgl0416 (Cgl0431)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD Mob_Pre
Motif
Other DBs
NCBI-GeneID: 1021444
NCBI-ProteinID: NP_599678
UniProt: Q8NT79
Position
454967..455986
Genome map
AA seq 339 aa AA seqDB search
MSTSSDYSHALIRRPRRLRANPAMRELVAETALRPADLILPMFFADGITEAREISSMPGV
YQHTEDSLLRAAHEALDAGVRCVDLFGVPVDADKDFNGSQAWSETGVLNRALSSLRKEFG
DDLLIMADTCLDEFTDHGHCGVVTEDRHGNAIVDNDATLPLYQQMAVAQARAGAHIVSPS
GMMDGQIAAIRAALDEEGYQDVAIMAYSAKYASAFFGPFREAVGSSLQGDRRTYQQDPAN
LRESLLEAELDIAEGADFIMVKPALPYLDVLTRIADTSPVPVAAYQVSGEYAMIQAAGRN
GWVDLDAVMMESLTSIKRAGANQILTYFAVDAARALRNA
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgagcacttcttctgattactcccacgcactaattcgtcgtccgcgccgacttcgcgcc
aaccctgcgatgcgggaactagtcgcggaaaccgcattgcgcccggcggatcttattctg
ccaatgttctttgcggatggaatcactgaggcacgtgagatctcctccatgccgggcgtt
tatcagcacactgaagattcgctgctgcgtgccgcccatgaggctttagatgctggtgtt
cgttgcgttgatctgttcggtgttccagtggatgcggacaaggacttcaatggttcccag
gcatggtctgaaaccggtgtgttgaaccgtgcactttcatcgctgcgtaaggaattcggc
gatgacctgctgattatggccgatacttgccttgatgagttcacggatcatggtcactgc
ggcgtagttaccgaggaccgccatggaaacgcaatcgtggacaacgatgccactttgccg
ctgtaccagcagatggctgttgctcaggctcgtgccggtgcacatattgtgagcccttcc
ggaatgatggacggccagatcgctgctattcgtgcagcgttggatgaggaaggctaccag
gacgtcgccatcatggcgtattccgctaagtatgcatcagcattcttcggacctttccgc
gaagcagtgggatcctccctccaaggcgatcgacgtacctaccagcaagatcctgcgaac
ctgcgtgagtctctccttgaggcagagctagatatcgcagaaggagcggacttcattatg
gtcaagcctgcactgccataccttgatgtgctgacccgcatcgctgatacctcacctgtc
ccagtggctgcctaccaagtttctggtgagtacgcgatgatccaagcagcaggccgcaac
ggttgggttgaccttgatgcagtgatgatggaatctttgacctccatcaagcgtgccggt
gcaaaccaaatcctcacgtactttgccgttgacgctgcccgcgcactgcgaaacgcttaa

DBGET integrated database retrieval system