KEGG   Corynebacterium glutamicum ATCC 13032 (Kyowa Hakko): NCgl0620Help
Entry
NCgl0620          CDS       T00102                                 

Gene name
Cgl0648
Definition
(RefSeq) bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/5,10-methylene-tetrahydrofolate cyclohydrolase
  KO
K01491  methylenetetrahydrofolate dehydrogenase (NADP+) / methenyltetrahydrofolate cyclohydrolase [EC:1.5.1.5 3.5.4.9]
Organism
cgl  Corynebacterium glutamicum ATCC 13032 (Kyowa Hakko)
Pathway
cgl00670  One carbon pool by folate
cgl01100  Metabolic pathways
cgl01120  Microbial metabolism in diverse environments
cgl01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cgl00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    NCgl0620 (Cgl0648)
Enzymes [BR:cgl01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.5  methylenetetrahydrofolate dehydrogenase (NADP+)
     NCgl0620 (Cgl0648)
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.9  methenyltetrahydrofolate cyclohydrolase
     NCgl0620 (Cgl0648)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: THF_DHG_CYH_C THF_DHG_CYH OCD_Mu_crystall Hydrolase
Motif
Other DBs
NCBI-GeneID: 1018649
NCBI-ProteinID: NP_599881
UniProt: Q8NSM0
Position
661166..662020
Genome map
AA seq 284 aa AA seqDB search
MTAIKLDGNLYRGEIFADLEQRVAALKEKGIVPGLATVLVGDDPASHSYVKMKHRDCEQI
GVNSIRKDLPADVTQEELFAVIDELNNDDSCTGYIVQLPLPKHLDENAVLERIDPAKDAD
GLHPVNLGKLVLNEPAPLPCTPNGSISLLRRFGVELDGAKVVVIGRGVTVGRPIGLMLTR
RSENSTVTLCHTGTKDLAAETRAADVIIAAAGQPHMLTADMVKPGAAVLDVGVSRKDGKL
LGDVHPDVWEVAGAVSPNPGGVGPLTRAFLVHNVVERAEKLAGL
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
gtgactgcaatcaaacttgatggaaacttataccgcggggaaattttcgccgacttggaa
cagcgcgttgctgcgttgaaggagaaagggattgtgccggggcttgccaccgtgctggtg
ggtgatgacccagcgagccactcttacgtgaagatgaagcatcgtgactgtgagcagatt
ggtgtgaactcgatccgtaaggatctgcctgctgatgtcacgcaggaagagcttttcgct
gtcatcgatgaactgaacaacgatgattcttgcactggttacattgtgcagcttcctttg
cctaagcacttggacgaaaacgctgtgctggagcgcattgatccagctaaggatgctgat
ggcctgcaccctgtaaacctgggcaagcttgtgctcaacgagccagctccactgccatgc
accccgaatggttccatcagcttgttgcgtcgtttcggcgttgagcttgatggcgcgaag
gttgttgtcattggccgtggcgtcaccgttggtcgcccaattggcctgatgctgacccgc
cgttccgagaactccacggttactttgtgccacactggcacgaaggatctggctgcggag
acccgtgcggctgacgtcatcattgctgcagctggtcagccgcacatgctgaccgcagac
atggtcaagccaggcgcagcggtgctcgatgtcggcgtctcccgcaaggacggcaagttg
cttggcgacgtccaccccgacgtgtgggaagtcgccggcgcggtctcaccaaacccaggc
ggcgttggccctctgacccgtgcattcttggtgcacaatgttgtcgagcgcgctgaaaag
ctggctggactctaa

DBGET integrated database retrieval system