KEGG   Corynebacterium glutamicum ATCC 13032 (Kyowa Hakko): NCgl0846Help
Entry
NCgl0846          CDS       T00102                                 

Gene name
Cgl0882
Definition
(RefSeq) UDP-glucose pyrophosphorylase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
cgl  Corynebacterium glutamicum ATCC 13032 (Kyowa Hakko)
Pathway
cgl00040  Pentose and glucuronate interconversions
cgl00052  Galactose metabolism
cgl00500  Starch and sucrose metabolism
cgl00520  Amino sugar and nucleotide sugar metabolism
cgl01100  Metabolic pathways
cgl01130  Biosynthesis of antibiotics
Module
cgl_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cgl00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    NCgl0846 (Cgl0882)
   00052 Galactose metabolism
    NCgl0846 (Cgl0882)
   00500 Starch and sucrose metabolism
    NCgl0846 (Cgl0882)
   00520 Amino sugar and nucleotide sugar metabolism
    NCgl0846 (Cgl0882)
Enzymes [BR:cgl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     NCgl0846 (Cgl0882)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3
Motif
Other DBs
NCBI-GeneID: 1018875
NCBI-ProteinID: NP_600109
UniProt: Q8NS04
Structure
PDB: 

Position
934375..935322
Genome map
AA seq 315 aa AA seqDB search
MSLPIDEHVNAVKTVVVPAAGLGTRFLPATKTVPKELLPVVDTPGIELIAAEAAELGATR
LAIITAPNKAGVLAHFERSSELEETLMERGKTDQVEIIRRAADLIKAVPVTQDKPLGLGH
AVGLAESVLDDDEDVVAVMLPDDLVLPTGVMERMAQVRAEFGGSVLCAVEVSEADVSKYG
IFEIEADTKDSDVKKVKGMVEKPAIEDAPSRLAATGRYLLDRKIFDALRRITPGAGGELQ
LTDAIDLLIDEGHPVHIVIHQGKRHDLGNPGGYIPACVDFGLSHPVYGAQLKDAIKQILA
EHEAAERIADDSQVK
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgagtttgcctatcgatgagcacgtgaacgcggttaaaaccgtcgtagtgcctgctgca
ggactgggaacccgattccttccggccaccaaaaccgtacccaaggagttgctgccggtt
gtcgataccccaggtattgagctgattgctgctgaggctgccgaacttggtgcgaccagg
ctggcgatcatcactgcgccaaacaaagctggggtacttgcacactttgagcgttcttct
gaattggaagaaacgctgatggagcgtggcaagactgaccaggtggagataatccgccgc
gccgccgatttaatcaaggcagttccagtaacccaggacaagccgctggggctaggtcat
gctgttggtttggctgagtctgtgttggatgatgatgaagatgtcgtagcggtgatgttg
ccggacgatctcgtgttgccaaccggtgttatggagcgcatggctcaggtccgagcagag
ttcggtggatctgtcctttgtgcagttgaggtttctgaagctgacgtttctaagtatggc
atctttgaaatcgaagctgacaccaaagattccgatgtcaaaaaggtcaagggcatggtg
gaaaaaccagccatcgaagacgcgccatcacgcctcgccgcgactggccgctacctgctt
gaccgaaaaatctttgacgccctgcgccgcatcacaccaggcgctggcggcgagttgcag
ctcaccgacgcgattgatttgcttatcgacgaaggccatccggtccatatcgtcattcac
cagggcaaacgccacgatcttggcaaccctggcgggtacattccggcgtgtgttgatttc
ggtctgtcccaccctgtttatggtgcgcagctaaaagatgcaatcaaacagattttggct
gaacatgaagctgcggaacgtattgcagacgattctcaagtaaaatag

DBGET integrated database retrieval system