KEGG   Corynebacterium glutamicum ATCC 13032 (Kyowa Hakko): NCgl1344Help
Entry
NCgl1344          CDS       T00102                                 

Gene name
Cgl1398
Definition
(RefSeq) ornithine carbamoyltransferase
  KO
K00611  ornithine carbamoyltransferase [EC:2.1.3.3]
Organism
cgl  Corynebacterium glutamicum ATCC 13032 (Kyowa Hakko)
Pathway
cgl00220  Arginine biosynthesis
cgl01100  Metabolic pathways
cgl01110  Biosynthesis of secondary metabolites
cgl01130  Biosynthesis of antibiotics
cgl01230  Biosynthesis of amino acids
Module
cgl_M00844  Arginine biosynthesis, ornithine => arginine
Brite
KEGG Orthology (KO) [BR:cgl00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    NCgl1344 (Cgl1398)
Enzymes [BR:cgl01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.3  ornithine carbamoyltransferase
     NCgl1344 (Cgl1398)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace OTCace_N
Motif
Other DBs
NCBI-GeneID: 1019374
NCBI-ProteinID: NP_600617
UniProt: Q59283
Position
1468565..1469524
Genome map
AA seq 319 aa AA seqDB search
MTSQPQVRHFLADDDLTPAEQAEVLTLAAKLKAAPFSERPLEGPKSVAVLFDKTSTRTRF
SFDAGIAHLGGHAIVVDSGSSQMGKGESLQDTAAVLSRYVEAIVWRTYAHSNFHAMAETS
TVPLVNSLSDDLHPCQILADLQTIVENLSPEEGPAGLKGKKAVYLGDGDNNMANSYMIGF
ATAGMDISIIAPEGFQPRAEFVERAEKRGQETGAKVVVTDSLDEVAGADVVITDTWVSMG
MENDGIDRTTPFVPYQVNDEVMAKANDGAIFLHCLPAYRGKEVAASVIDGPASKVFDEAE
NRLHAQKALLVWLLANQPR
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgacttcacaaccacaggttcgccattttctggctgatgatgatctcacccctgcagag
caggcagaggttttgaccctagccgcaaagctcaaggcagcgccgttttcggagcgtcca
ctcgagggaccaaagtccgttgcagttctttttgataagacttcaactcgtactcgcttc
tccttcgacgcgggcatcgctcatttgggtggacacgccatcgtcgtggattccggtagc
tcacagatgggtaagggcgagtccctgcaggacaccgcagctgtattgtcccgctacgtg
gaagcaattgtgtggcgcacctacgcacacagcaatttccacgccatggcggagacgtcc
actgtgccgctggtgaactccttgtccgatgatctgcacccatgccagattctggctgat
ctgcagactatcgtggaaaacctcagccctgaagaaggcccagcaggccttaagggtaag
aaggctgtgtacctgggcgatggcgacaacaacatggccaactcctacatgattggcttt
gccaccgcgggcatggatatttccatcatcgctcctgaagggttccagcctcgtgcggaa
ttcgtggagcgcgcggaaaagcgtggccaggaaaccggcgcgaaggttgttgtcaccgac
agcctcgacgaggttgccggcgccgatgttgtcatcaccgatacctgggtatccatgggt
atggaaaacgacggcatcgatcgcaccacacctttcgttccttaccaggtcaacgatgag
gtcatggcgaaagctaacgacggcgccatcttcctgcactgccttcctgcctaccgtggc
aaagaagtggcagcctccgtgattgatggaccagcgtccaaagttttcgatgaagcagaa
aaccgcctccacgctcagaaagcactgctggtgtggctgctggccaaccagccgaggtaa

DBGET integrated database retrieval system