KEGG   Corynebacterium glutamicum ATCC 13032 (Kyowa Hakko): NCgl1593
Entry
NCgl1593          CDS       T00102                                 

Gene name
secF
Definition
(RefSeq) preprotein translocase subunit SecF
  KO
K03074  preprotein translocase subunit SecF
Organism
cgl  Corynebacterium glutamicum ATCC 13032 (Kyowa Hakko)
Pathway
cgl03060  Protein export
cgl03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:cgl00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    NCgl1593 (secF)
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    NCgl1593 (secF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:cgl02044]
    NCgl1593 (secF)
Secretion system [BR:cgl02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components
   NCgl1593 (secF)
SSDB
Motif
Pfam: SecD_SecF Sec_GG
Other DBs
NCBI-GeneID: 1019624
NCBI-ProteinID: NP_600869
UniProt: Q79VF7
Position
complement(1757586..1758797)
AA seq 403 aa
MTDSQTESLSTQSVKPAKKRSWFNSLYTGDGGIDFIAKTKLWYWITGILLVISILFIAIR
GFSLSIDFQGGTKMSMPASDYSTEQVEETFTEATGITPEIVQIVGSGDARTLEIYSERLS
DEDVEKARLAIYEEYQPLNSEGQPSPDAIGNSTVSESWGSTITQRMVLALIAFLVIAAIY
IAFRLEREMAIAAMAALVVDGIVIAGIYAVIGLEVSPATVIGLLTVLTFSIYDTVVVFDK
VRENTEGFEGSRRRTYAEQANLAVNQTFMRSISTTIISALPIIALMVVAVWMMGVGTLKD
LALIQLIGVIEGTFSSVFLATPLLVSLKNRLSKTKAHTASVMKLRDGQSTLIDATPHTNA
DASAHGTESDTDGVTPEAPAKRTVSKPIVDDHRSSGTWRPGRS
NT seq 1212 nt   +upstreamnt  +downstreamnt
atgactgattcccagactgaatcactgtcaactcagagcgtaaaaccagccaaaaaacgc
agttggttcaacagcctctacaccggtgacggcggcattgacttcatcgccaaaaccaaa
ctgtggtactggatcaccggcattttgctggttatctcgatcctgttcatcgccatccgt
ggcttctccctgagcatcgatttccagggcggtaccaagatgagcatgccagcatcggat
tactccaccgaacaggtggaggaaacctttactgaagccaccggcattactccggaaatc
gtgcagatcgtcggttccggcgacgcccgcaccctggagatctactccgagcgactcagc
gatgaggatgtagaaaaagcccgcctggcgatctacgaggaataccaacccctaaactct
gagggccagccaagcccagatgccatcggtaattccacggtgtcggaatcatggggttcc
accatcacccaacgcatggtgttggctctgattgccttcctggttattgcagcgatctac
attgctttccgcctcgagcgtgaaatggccatcgccgccatggcagcattggttgttgac
ggcatcgtcatcgccggcatctacgccgtcatcggcctcgaagtatccccagcaaccgtc
atcggtctgctcaccgtgctgaccttctccatctacgacaccgtcgtggtctttgacaag
gtcagagaaaacaccgaaggcttcgaaggcagccgcagacgaacctacgccgaacaagcc
aacctggcggtcaaccagaccttcatgcgttcgatctccacgacaatcatctctgcactt
ccgatcatcgctttgatggttgtcgccgtctggatgatgggtgttggcaccctcaaagac
ctcgcactgatccagctgatcggcgtcatcgaaggcaccttctcctccgtcttcctggca
accccactgctggtcagcctgaaaaaccgcctgagcaaaaccaaagcgcacaccgcttcc
gttatgaagttgcgcgacggccaaagcacgcttatcgacgccaccccacacaccaacgcc
gacgcctccgcgcacggcaccgaaagcgacactgacggtgtgacccccgaagcacctgca
aaacgtacagtaagcaaacccattgtggatgatcaccgatcaagcggaacctggcgacca
ggcagaagctaa

DBGET integrated database retrieval system