KEGG   Corynebacterium glutamicum ATCC 13032 (Kyowa Hakko): NCgl1876Help
Entry
NCgl1876          CDS       T00102                                 

Gene name
Cgl1951
Definition
(RefSeq) glutamate ABC transporter periplasmic component
  KO
K10005  glutamate transport system substrate-binding protein
Organism
cgl  Corynebacterium glutamicum ATCC 13032 (Kyowa Hakko)
Pathway
cgl02010  ABC transporters
Module
cgl_M00233  Glutamate transport system
Brite
KEGG Orthology (KO) [BR:cgl00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    NCgl1876 (Cgl1951)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cgl02000]
    NCgl1876 (Cgl1951)
Transporters [BR:cgl02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Glutamate transporter [MD:M00233] [OT]
    NCgl1876 (Cgl1951)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_3 Phosphonate-bd Lig_chan-Glu_bd Transferrin
Motif
Other DBs
NCBI-GeneID: 1019908
NCBI-ProteinID: NP_601158
UniProt: P48242
Position
2060620..2061507
Genome map
AA seq 295 aa AA seqDB search
MSAKRTFTRIGAILGATALAGVTLTACGDSSGGDGFLAAIENGSVNVGTKYDQPGLGLRN
PDNSMSGLDVDVAEYVVNSIADDKGWDHPTIEWRESPSAQRETLIQNGEVDMIAATYSIN
AGRSESVNFGGPYLLTHQALLVRQDDDRIETLEDLDNGLILCSVSGSTPAQKVKDVLPGV
QLQEYDTYSSCVEALSQGNVDALTTDATILFGYSQQYEGDFRVVEMEKDGEPFTDEYYGI
GLKKDDQEGTDAINAALERMYADGTFQRLLTENLGEDSVVVEEGTPGDLSFLDAS
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcaaagcgtacttttacccgtatcggtgcgattcttggagcaactgcacttgcc
ggagttaccctcaccgcctgtggtgattcaagcggtggcgacggattcctcgcagccatt
gaaaatggttctgtcaatgtcggcaccaaatacgatcagcctggtcttggcctccgcaac
ccagacaactccatgagcggtctcgacgtggatgttgctgaatacgtagtcaactccatc
gctgatgacaagggctgggatcaccccaccatcgaatggcgtgaatccccttctgcgcag
cgtgaaaccctcattcaaaacggtgaggtagacatgatcgcagcaacctactccatcaac
gctggccgttcagagtccgtcaacttcggtggcccatacctgcttacccaccaggctctg
cttgttcgccaagatgacgatcgcattgaaaccctcgaggacttggataacggtttgatc
ctgtgctccgtttccggatccactccagctcagaaggtcaaggatgtcctcccaggcgtt
cagctccaagaatacgacacctactcttcctgtgttgaggcactgtcccagggcaacgtt
gacgccctgaccactgacgccaccatcctcttcggctactcccagcagtacgaaggcgac
ttccgcgttgtggaaatggaaaaggacggcgagccattcaccgacgagtactacggcatt
ggcctgaagaaggatgaccaggaaggcaccgacgctatcaacgccgcacttgagcgcatg
tacgctgacggcaccttccagcgactgctcaccgagaacctcggtgaagactccgtggtt
gttgaagaaggcaccccaggtgacctctccttcctcgacgcaagctag

DBGET integrated database retrieval system