KEGG   Corynebacterium glutamicum ATCC 13032 (Kyowa Hakko): NCgl2309Help
Entry
NCgl2309          CDS       T00102                                 

Gene name
Cgl2392
Definition
(RefSeq) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
cgl  Corynebacterium glutamicum ATCC 13032 (Kyowa Hakko)
Pathway
cgl00071  Fatty acid degradation
cgl00072  Synthesis and degradation of ketone bodies
cgl00280  Valine, leucine and isoleucine degradation
cgl00310  Lysine degradation
cgl00362  Benzoate degradation
cgl00380  Tryptophan metabolism
cgl00620  Pyruvate metabolism
cgl00630  Glyoxylate and dicarboxylate metabolism
cgl00640  Propanoate metabolism
cgl00650  Butanoate metabolism
cgl00900  Terpenoid backbone biosynthesis
cgl01100  Metabolic pathways
cgl01110  Biosynthesis of secondary metabolites
cgl01120  Microbial metabolism in diverse environments
cgl01130  Biosynthesis of antibiotics
cgl01200  Carbon metabolism
cgl01212  Fatty acid metabolism
cgl02020  Two-component system
Brite
KEGG Orthology (KO) [BR:cgl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    NCgl2309 (Cgl2392)
   00630 Glyoxylate and dicarboxylate metabolism
    NCgl2309 (Cgl2392)
   00640 Propanoate metabolism
    NCgl2309 (Cgl2392)
   00650 Butanoate metabolism
    NCgl2309 (Cgl2392)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    NCgl2309 (Cgl2392)
   00072 Synthesis and degradation of ketone bodies
    NCgl2309 (Cgl2392)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    NCgl2309 (Cgl2392)
   00310 Lysine degradation
    NCgl2309 (Cgl2392)
   00380 Tryptophan metabolism
    NCgl2309 (Cgl2392)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    NCgl2309 (Cgl2392)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    NCgl2309 (Cgl2392)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    NCgl2309 (Cgl2392)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cgl04147]
    NCgl2309 (Cgl2392)
Enzymes [BR:cgl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     NCgl2309 (Cgl2392)
Exosome [BR:cgl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   NCgl2309 (Cgl2392)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-GeneID: 1020342
NCBI-ProteinID: NP_601593
UniProt: Q8NN21
Position
2534202..2535428
Genome map
AA seq 408 aa AA seqDB search
MNPQDIVICSPLRTPVGAYGGSFTGVPVEELATTVINAIVEATGITGDDVDDLILGQASP
NGAAPALGRVVALDSKLGQNVPGMQLDRRCGSGLQAIVTAAAHVASGAADLIIAGGAESM
SRVEYTVSGDIRWGVKGGDMQLRDRLAEARETAGGRNHPIPGGMIETAENLRREYGISRE
EQDKISAASQQRWGKAADAGLFDDEIVPVTVPAKKRGQEPTIVSRDEHGRPGTTVEKLAA
LRPIMGRQDAEATVTAGNASGQNDGAAAVIVTTRAKAEEKGLRPVMRLAGWSVAAVPPET
MGIGPVPATKKVLDRLGLTLEDIGAIELNEAFAAQALSVLKEWNISWEDERVNPLGSGIS
MGHPVGATGARMAVTLAHRMQRENTQYGLATMCIGGGQGLAAVFEKEN
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgaaccctcaagatattgtcatctgttccccattgcgcaccccagttggtgcttacggc
ggatccttcaccggcgtccctgttgaagaattggccaccaccgtgatcaacgcgatcgtt
gaggcaaccggcatcaccggcgacgatgtggacgatctgatcctcggccaggcatccccc
aacggtgcggctccagcactgggccgtgttgttgctctagattccaagcttggccaaaac
gttccaggcatgcagcttgatcgccgctgtggttccggcctgcaggcaatcgtcaccgct
gctgcacacgttgcatccggcgctgctgatctgatcatcgcaggtggcgcagaatccatg
agccgcgttgagtacaccgtgtccggcgatatccgttggggtgtcaagggcggcgacatg
cagcttcgtgaccgccttgcagaagcacgcgaaaccgctggcggacgcaaccacccgatc
cctggtggcatgatcgagaccgctgagaacctgcgtcgcgaatacggcatctcccgcgag
gagcaggacaagatctccgcagcgtcccagcagcgttggggcaaggctgctgatgcgggg
cttttcgacgacgagatcgtgccagtcaccgtccctgccaagaagcgcggccaggagcca
accatcgtttctcgagacgagcatggtcgaccaggaacaaccgtcgaaaagcttgctgct
ttgcgccccatcatgggccgccaggatgcggaagcaaccgtcaccgctggcaacgcgtcc
ggccaaaatgatggcgctgctgccgtcatcgtgaccactcgcgccaaggccgaggagaag
ggcctgcgcccagtcatgcgtttggctggctggtctgtggctgctgttcccccagagacc
atgggtattggacctgttcctgccaccaagaaggtcctggatcgtttgggccttaccctg
gaggacatcggcgcgatcgaactcaacgaagctttcgcagctcaggcactgtctgtgctg
aaggaatggaacatttcttgggaagatgagcgcgtcaacccactgggttccggtatttcc
atgggacacccagtcggtgccaccggtgctcgcatggcagtaaccttggctcaccgcatg
cagcgtgaaaacactcagtacggactggccaccatgtgcatcggtggcggccagggtctt
gcagctgtctttgaaaaggagaactaa

DBGET integrated database retrieval system