KEGG   Corynebacterium glutamicum ATCC 13032 (Kyowa Hakko): NCgl2523Help
Entry
NCgl2523          CDS       T00102                                 

Gene name
Cgl2612
Definition
(RefSeq) transcriptional regulator
Organism
cgl  Corynebacterium glutamicum ATCC 13032 (Kyowa Hakko)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TetR_C_28 TetR_N
Motif
Other DBs
NCBI-GeneID: 1020559
NCBI-ProteinID: NP_601813
UniProt: Q8NMG3
Structure
PDB: 

Position
2780440..2780973
Genome map
AA seq 177 aa AA seqDB search
MRTSKKEMILRTAIDYIGEYSLETLSYDSLAEATGLSKSGLIYHFPSRHALLLGMHELLA
DDWDKELRDITRDPEDPLERLRAVVVTLAENVSRPELLLLIDAPSHPDFLNAWRTVNHQW
IPDTDDLENDAHKRAVYLVQLAADGLFVHDYIHDDVLSKSKRQAMLETILELIPSQT
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
atgcgcactagtaaaaaagagatgattctgcgcacggccatcgattatatcggcgagtac
agcctcgagacgctgagttacgattcgctcgccgaggcgaccggtctgtccaagtcgggc
ttgatttatcatttccccagccgccatgcgctgcttttaggcatgcacgagttgcttgcc
gacgactgggacaaggaattgcgcgacataacccgcgacccagaggatccacttgagcga
ttgcgcgccgtcgtggttacgcttgctgaaaacgtttcgcgccccgagctgcttttgctt
atcgacgccccctcccacccggatttccttaacgcctggcgcactgtaaatcatcaatgg
atccccgacaccgatgatctggaaaacgatgcccacaaacgcgccgtctacctggtgcag
ctcgcagccgatggcctcttcgtgcacgattacattcatgatgatgtcctcagcaagtcc
aagcgccaagccatgctggaaacaattctcgagctgataccaagccagacttaa

DBGET integrated database retrieval system