KEGG   Corynebacterium glutamicum ATCC 13032 (Kyowa Hakko): NCgl2680
Entry
NCgl2680          CDS       T00102                                 

Gene name
Cgl2777
Definition
(RefSeq) multidrug resistance protein
  KO
K18833  MFS transporter, DHA3 family, multidrug efflux protein
Organism
cgl  Corynebacterium glutamicum ATCC 13032 (Kyowa Hakko)
Brite
KEGG Orthology (KO) [BR:cgl00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cgl02000]
    NCgl2680 (Cgl2777)
   01504 Antimicrobial resistance genes [BR:cgl01504]
    NCgl2680 (Cgl2777)
Transporters [BR:cgl02000]
 Major facilitator superfamily (MFS)
  Drug transporters
   Drug:H+ antiporter-3 (12 spanner) (DHA3) [TC:2.A.1.21]
    NCgl2680 (Cgl2777)
Antimicrobial resistance genes [BR:cgl01504]
 Gene variants
  Macrolide resistance genes
   Transporters
    NCgl2680 (Cgl2777)
SSDB
Motif
Pfam: MFS_1 Wzy_C_2
Other DBs
NCBI-GeneID: 1020721
NCBI-ProteinID: NP_601971
UniProt: Q79VC7
Position
2961343..2962722
AA seq 459 aa
MSTFHKVLINTMISNVTTGFLFFAVVFWMYLSTGNVALTGIVSGIYMGLIAVCSIFFGTV
VDHNRKKSVMLFSSVTTLVFYCLSALVWVFWLEEDGLSIGNTALWVFVSFILIGSIVEHM
RNIALSTVVTLLVPEAERDKANGLVGAVQGVGFLVTSVIAGSAIGFLGMEITLWICLGLS
LVALLHLLPIRVDEPEIITQEDAQPTVSDDSVPTPTSDLAIVSKGIDLKGSMKIILSVPG
LLALVLFASFNNLIGGVYSALMDPYGLELFSPQLWGLLLGLTSLGFIVGGAVISKTGLGK
NPVRTLLLVNVGVAFVGMLFAIREWWWLYILGIFIFMAITPAAEAAEQTILQRVVPFRQQ
GRVFGLAMAVEMAANPLSTVIVAILAEAYLIPWMAGPGADTIWGVILGEGKARGMALMFL
ASGAIMLVVVLLAFMSRSYRKLSQYYATTSQDIAGAAEK
NT seq 1380 nt   +upstreamnt  +downstreamnt
gtgtccacgtttcataaagttctgatcaacaccatgatctccaacgtcaccactggattt
ctgttctttgccgtggtgttttggatgtatctttccactggcaacgtcgcactgaccggc
atcgtcagtggaatttacatgggtttgatcgccgtttgttccatctttttcggaaccgtt
gttgatcacaatcgcaagaagtccgtcatgctgttttccagcgtcaccacactcgtgttt
tattgtctcagtgccctggtgtgggtgttttggctggaggaagacggcctgagcatcgga
aataccgccctgtgggtgttcgtttctttcatcctcatcggatcaatcgtggaacacatg
cgcaacatcgcactgtccaccgtggtcacgctgttggttcctgaagctgaacgcgacaaa
gcaaacggcctggtaggagccgtgcaaggtgttggatttttagtcaccagcgtcattgct
ggttccgccatcgggttcttgggcatggaaatcaccctgtggatctgccttgggctctca
cttgtcgcgctgctgcacctgctgccgattcgcgtcgacgaaccggaaatcatcacccaa
gaagacgcacagcctactgtttctgacgattcagttcccacacctacctccgatttggcg
atcgtgtccaaaggcatcgacctaaaaggatcaatgaaaatcatcctgagtgttccggga
ctgctcgcgcttgtgttgtttgcgtccttcaacaacctcatcggcggcgtgtactccgca
ctcatggacccttacggcctggaacttttcagcccacagctgtgggggctactgcttgga
ctcaccagcctcggcttcatcgttggtggtgctgtgatctccaaaactggcttgggcaaa
aaccctgtgcgcaccttgctgctggttaatgttggtgtggcttttgttggcatgttattt
gccattcgcgaatggtggtggctctacatcctgggcattttcatcttcatggctatcacc
ccagctgccgaagccgcagaacaaaccatccttcaacgagtcgtcccattccgccaacaa
ggccgcgtatttggactagccatggcagtggaaatggcagccaacccgctctccacagtg
atcgtggcgattttggccgaagcctacctcattccatggatggctggccccggcgcggac
accatctggggcgtgatcctcggcgagggtaaagctcgcggcatggcactgatgttcctc
gcatcaggtgccatcatgttggttgtcgtgctgttggcattcatgtcgaggtcctaccgg
aaactcagccagtactacgccaccaccagccaagacattgcgggagctgctgagaagtaa

DBGET integrated database retrieval system