KEGG   Corynebacterium glutamicum ATCC 13032 (Kyowa Hakko): NCgl2932Help
Entry
NCgl2932          CDS       T00102                                 

Gene name
trpA
Definition
(RefSeq) tryptophan synthase subunit alpha
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
cgl  Corynebacterium glutamicum ATCC 13032 (Kyowa Hakko)
Pathway
cgl00260  Glycine, serine and threonine metabolism
cgl00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cgl01100  Metabolic pathways
cgl01110  Biosynthesis of secondary metabolites
cgl01130  Biosynthesis of antibiotics
cgl01230  Biosynthesis of amino acids
Module
cgl_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cgl00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NCgl2932 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    NCgl2932 (trpA)
Enzymes [BR:cgl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     NCgl2932 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA IMPDH His_biosynth NMO FMN_dh Amidohydro_2
Motif
Other DBs
NCBI-GeneID: 1020978
NCBI-ProteinID: NP_602228
UniProt: P06562
Position
3239333..3240175
Genome map
AA seq 280 aa AA seqDB search
MSRYDDLFARLDTAGEGAFVPFIMLSDPSPEEAFQIISTAIEAGADALELGVPFSDPVAD
GPTVAESHLRALDGGATVDSALEQIKRVRAAYPEVPIGMLIYGNVPFTRGLDRFYQEFAE
AGADSILLPDVPVREGAPFSAAAAAAGIDPIYIAPANASEKTLEGVSAASKGYIYAISRD
GVTGTERESSTDGLSAVVDNIKKFDGAPILLGFGISSPQHVADAIAAGASGAITGSAITK
IIASHCEGEHPNPSTIRDMDGLKKDLTEFISAMKAATKKV
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atgagccgttacgacgatctttttgcacgcctcgacacggcaggggagggcgcctttgtt
cccttcatcatgctgagcgacccttcaccagaggaggctttccagatcatctccacagca
atcgaagctggcgcagatgcactggaacttggcgtacctttctccgacccagttgccgat
ggccccaccgtcgcggaatcccacctccgcgcactcgacggcggcgccaccgtagacagc
gcactcgagcagatcaagcgcgtgcgcgcagcctacccagaggttcccatcggaatgctc
atctacggcaacgttcctttcacccgtggcttggatcgcttctaccaagagttcgctgaa
gctggcgcagactccatcctcctgccagacgtcccagtccgcgaaggcgcaccgttttct
gcagcagctgcagcagccggaattgatcccatttacatcgctccggccaacgccagcgag
aaaaccctcgagggtgtctccgccgcatcaaagggctacatctacgccatctcccgcgac
ggcgtcaccggcaccgaacgtgaatcatccaccgacggcctgtccgcagtggtggacaac
atcaagaaatttgatggcgcacccatcctcttgggcttcggcatctcatcccctcagcac
gtggcagacgcgattgcagcgggtgcttccggtgcgatcacgggttccgcgatcaccaag
atcattgcttcccactgcgaaggtgagcacccgaacccgtccaccattcgagatatggac
ggtttgaagaaggatctcactgagttcatctctgcgatgaaggcagcgaccaagaaggtt
tag

DBGET integrated database retrieval system