KEGG   Corynebacterium glutamicum MB001: cgp_0129Help
Entry
cgp_0129          CDS       T02791                                 

Gene name
putA
Definition
(GenBank) proline dehydrogenase/delta-1-pyrroline-5-carboxylate dehydrogenase
  KO
K13821  RHH-type transcriptional regulator, proline utilization regulon repressor / proline dehydrogenase / delta 1-pyrroline-5-carboxylate dehydrogenase [EC:1.5.5.2 1.2.1.88]
Organism
cgm  Corynebacterium glutamicum MB001
Pathway
cgm00250  Alanine, aspartate and glutamate metabolism
cgm00330  Arginine and proline metabolism
cgm01100  Metabolic pathways
cgm01110  Biosynthesis of secondary metabolites
cgm01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:cgm00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    cgp_0129 (putA)
   00330 Arginine and proline metabolism
    cgp_0129 (putA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cgm03000]
    cgp_0129 (putA)
Enzymes [BR:cgm01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.88  L-glutamate gamma-semialdehyde dehydrogenase
     cgp_0129 (putA)
  1.5  Acting on the CH-NH group of donors
   1.5.5  With a quinone or similar compound as acceptor
    1.5.5.2  proline dehydrogenase
     cgp_0129 (putA)
Transcription factors [BR:cgm03000]
 Prokaryotic Type
  Ribbon-helix-helix
   Other families
    cgp_0129 (putA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh Pro_dh Cas_Csa5 TetR_C_18
Motif
Other DBs
NCBI-ProteinID: AGT04109
Position
107414..110872
Genome map
AA seq 1152 aa AA seqDB search
MTSMNLPIELATLSDQAVDKVRSWLEYSKKESVPNADAKRLAAVLQDPNGLEFTVGFVDR
VVRTEDREAAAHALYELGKIAPSTMSFLDRAQIQAGSLVGRALPQVVVPAARARIRQMVG
HMIVDARDKQFAKAVAEIQSDGHRLNINLLGEAVLGRKEAAKHLDDTVRLLRRPDVEYVS
IKVSSVASQISMWGFEDTVNYVVEQLTPLYIEAARAPKGTKFINLDMEEYRDLRLTMEVF
KRLLSNPELHELEAGIVLQAYLPDALGAIQDLAQFGRERVNTGGAGVKVRLVKGANLPME
HVHAQITGWPVATEPSKQATDANYKRVLYWTMRKENMEGLRLGVAGHNLFDIAFAHLLSV
ERGVADRVEFEMLQGMASDQARAVSVDVGELLLYVPAVRPQEFDVAISYLVRRLEENAAS
ENFMSAIFDLDADNPSFKREESRFRASISDLATLIDVPAPGPNHTQDRSKETLLDAPLVP
FINEPDTNPALIQNQQWATKAVATAAEPGWLEKQTKPEVLEEGDVDKLINDVRDAAEAWA
ARPARERAEILYKTAEILRVRRGHLISVTAAEVGKAVEQTDPEISEAIDFARYYAHLALE
LDDVDNAEFTPDRVVVVTPPWNFPIAIPAGSTFAALAAGAGVIHKPSKPSQHCSAAVVEA
LWEAGVPREVLHCIYPANRDVGCALISHEHVDRVILTGSSETAAMFSSWRPELTINGETS
GKNAIVVTPSADRDLAVADLVKSAFGHAGQKCSAASLGILVGSVYESERFRKQLVDAASS
LIVDWPTNPSATVGPLTELPSDKLHHALTTLEEGESWLLKPRQLDDTGRLWSPGIKEGVK
PGTFFHLTEVFGPVLGLMKATDLNEAIEFQNGNDFGLTGGLQSLDADEVRTWLDHVDVGN
AYVNRGITGAIVQRQSFGGWKKSSVGLGSKAGGPNYVMLMGTWADAPSHHAPRETNPLIS
KLDLPGEELEWLEKANASDETAWNTEFGSPRDPSGLDVEANIFRYRPAEVVLRLDDSATP
RETARALLAARRAGVTPRVLQTPGVSEQVREVLSAAGVSAETVDDSVFISNVLRGEYDEN
SSVRVRYLGKVSDTVRERLSVRPEVVLLDDAVTASGRVELRYWLKEQAISMTLHRFGNPV
AAFHELAEELKR
NT seq 3459 nt NT seq  +upstreamnt  +downstreamnt
atgacgtcgatgaatctgcctattgagttggctacgctgtctgaccaggctgtggacaag
gtgcgctcctggctggagtacagcaaaaaggaaagcgtgcccaatgccgatgcgaagcgt
ctagctgcagtgttgcaggatcctaatggtttggaattcacggttggtttcgtggatcga
gtggttcgaactgaggatcgtgaagcggcagcgcatgcgttgtatgagttgggcaagatt
gctccgtcgacgatgtcctttttggatcgggcgcagattcaggccggttctttggtgggg
cgggcgttgccgcaggttgtggttcctgcggcgcgggctcgaatccggcagatggttggg
cacatgattgtggatgcccgcgacaagcagttcgccaaggctgtcgctgagattcagtcg
gatgggcaccgcctgaacatcaatttgctaggtgaagcggtgttgggccgaaaggaggca
gcgaagcatttggatgacacggtgcggttgttgcgccgtccggatgtggaatatgtgtcc
atcaaggtctcttcggtggcatcgcagatttcgatgtggggtttcgaagacaccgttaat
tatgttgtggaacagctgacacctttatatatagaggccgcgcgggcgccgaaaggcacg
aagttcatcaacctggacatggaggaataccgcgatctgcgcctgactatggaggtgttc
aagcggctgctctccaatccagagctgcatgaactagaagccggaattgtgttgcaggcg
taccttcccgatgccctcggtgcaatccaggacttggcgcagttcggccgcgagcgcgtc
aacacaggcggggcgggcgttaaggttcgcctggtcaagggtgctaatttgcctatggag
cacgtccacgcgcagatcaccggctggccagttgccacagaaccttccaaacaagccacc
gatgccaattacaagcgcgtcctctattggacgatgcgcaaagaaaacatggagggcctg
cgcctgggcgttgccggccacaaccttttcgacatagcattcgcacatttgctctctgtg
gagcgtggggtagcggaccgtgtggagttcgaaatgctgcagggcatggcgtccgatcag
gcgcgcgccgtcagcgttgacgtcggtgagctgctgctttacgtaccagccgtgcgccca
caagaattcgacgtggccatttcttacctcgtgcgccgcctcgaggaaaacgccgcgagc
gaaaacttcatgtccgccatcttcgacctcgacgccgacaacccgtccttcaagcgagag
gagagccgcttccgcgcctccatatctgacctcgccacgctcatcgacgtgcccgcgccc
ggccccaaccacacacaagaccgcagcaaagagacgcttctcgacgcccccctcgtccca
tttatcaacgagcccgacaccaacccagcgctcatccaaaaccaacagtgggccacaaaa
gccgtcgccaccgcagcagagcccggttggttggaaaaacaaacaaagccggaggtgttg
gaagagggggacgtcgacaagctaattaacgatgtgcgcgacgctgctgaagcgtgggca
gcgcgcccagcccgtgaacgcgctgagattttgtacaagaccgccgagattttgcgcgtg
cgacgcggacacctgatctcagtgacggccgcggaggtgggcaaagctgtggaacaaacc
gacccggaaatctctgaagccattgatttcgcccgctactacgcgcatttggccctggaa
ttggacgacgtagacaatgcggaattcaccccagatcgcgtcgttgtggtgaccccgccc
tggaatttccccatcgcgatccccgctggatcgactttcgcagcactcgcggcgggcgct
ggcgtgatccacaaaccctcaaagcctagccaacattgctccgctgcagtggtcgaagcc
ctctgggaagccggcgttccccgcgaggttctgcattgcatttacccagctaatcgcgat
gttggatgtgcgttgatcagccatgaacacgtcgaccgcgtcattttgaccggctcctcc
gagaccgccgcgatgttctcctcctggcgaccagaactcaccatcaacggcgaaacctcc
ggcaaaaacgccatcgtggtcaccccatctgccgaccgcgacctcgccgtcgccgacctg
gtgaaatccgccttcggccatgcaggacaaaaatgttccgcagcctccctcggcatcttg
gtaggcagcgtctacgaatcagaacgcttccggaaacagctggtagacgccgcatcctca
ctcatcgtcgactggcctaccaacccctccgcaaccgtcggaccactcaccgaactcccc
agcgataaactccaccacgccctaaccaccctcgaagaaggagaaagctggctgctgaaa
ccccgacaactcgacgacaccggccgactctggtcacccggcatcaaagaaggcgtcaaa
ccaggaaccttcttccacctcacagaagtattcggaccagtcctcggcctgatgaaagcc
accgacctcaatgaagccatcgaattccaaaacggcaacgacttcggactcaccggcgga
ctccaatccctcgacgccgacgaagtccgcacctggcttgaccacgtcgatgtcggaaac
gcctacgtcaaccgcggcatcaccggcgccattgtccaacgccaatccttcggaggctgg
aaaaaatcctccgtcggcctcggatccaaagccggaggacccaactatgtcatgctcatg
ggaacctgggccgacgcgccaagccaccacgccccacgcgaaacaaacccgctgatcagc
aaactggatctccccggagaagagctcgaatggctcgaaaaagccaacgccagcgatgaa
acagcatggaacacggaattcggcagcccacgcgacccctccggcctcgatgtagaagcc
aacattttccgctaccgaccagcagaggtagtactccgactcgacgattccgccacaccc
cgagaaactgcccgcgcattgttggcagcccgtcgcgccggggttactccgcgagttctt
caaacaccaggtgtttcagagcaagtccgcgaagtattgtccgctgctggagtgagtgca
gaaacagtcgatgattcggtatttatttccaacgtgttgcgcggcgaatacgacgagaac
tccagcgtccgagtccgctacctgggcaaagttagcgacactgtccgtgaacgcctatct
gtacggcccgaagttgttctgcttgacgatgcagtaactgcctccggtcgagttgaatta
cgttactggctcaaagaacaagcaatttccatgacgttgcaccgttttggaaacccagtt
gcggccttccacgagttggcggaggaacttaaacgttga

DBGET integrated database retrieval system